BLASTX nr result
ID: Dioscorea21_contig00015904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00015904 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285282.1| PREDICTED: interferon-related developmental ... 60 1e-07 ref|XP_002510104.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 ref|XP_002301151.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002320034.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002285282.1| PREDICTED: interferon-related developmental regulator 1 [Vitis vinifera] gi|302142206|emb|CBI19409.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -3 Query: 356 GKKGNLSSKEKRMFMSPNSVVNKERTQMRNKYRSWAQDRNQGHYSV 219 G + +LSS EKRM+ SPNSVVNK RTQ+ NK R +Q RN GHY+V Sbjct: 394 GSEHHLSSGEKRMYKSPNSVVNKARTQLLNKQRMLSQGRNAGHYAV 439 >ref|XP_002510104.1| conserved hypothetical protein [Ricinus communis] gi|223550805|gb|EEF52291.1| conserved hypothetical protein [Ricinus communis] Length = 448 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = -3 Query: 356 GKKGNLSSKEKRMFMSPNSVVNKERTQMRNKYRSWAQDRNQGHYSVIAED 207 G + +SS EKRMF SPNSV+NK RTQ NK R ++DRN GH++V + D Sbjct: 396 GVEHQMSSCEKRMFRSPNSVLNKARTQFLNKQRMLSKDRNVGHFAVNSGD 445 >ref|XP_002301151.1| predicted protein [Populus trichocarpa] gi|222842877|gb|EEE80424.1| predicted protein [Populus trichocarpa] Length = 437 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -3 Query: 356 GKKGNLSSKEKRMFMSPNSVVNKERTQMRNKYRSWAQDRNQGHYSV 219 G + +SS EKRMF SPNSV+NK RTQ NK R ++DRN GH++V Sbjct: 386 GVEHQMSSGEKRMFRSPNSVLNKARTQFLNKQRMLSKDRNVGHFAV 431 >ref|XP_002320034.1| predicted protein [Populus trichocarpa] gi|222860807|gb|EEE98349.1| predicted protein [Populus trichocarpa] Length = 430 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -3 Query: 356 GKKGNLSSKEKRMFMSPNSVVNKERTQMRNKYRSWAQDRNQGHYSV 219 G + +SS EKRMF SPNS+ NK RTQ NK R ++DRN GH++V Sbjct: 378 GVEHQMSSGEKRMFRSPNSIQNKARTQFLNKQRMLSKDRNVGHFAV 423