BLASTX nr result
ID: Dioscorea21_contig00015654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00015654 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO35357.1| Acyl-CoA dehydrogenase [Elaeis oleifera] 92 3e-17 ref|XP_002868103.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata ... 91 8e-17 emb|CAB10450.1| acyl-CoA oxidase like protein [Arabidopsis thali... 91 1e-16 pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 gi|5... 91 1e-16 ref|NP_567513.4| peroxisomal acyl-coenzyme A oxidase 1 [Arabidop... 91 1e-16 >gb|ACO35357.1| Acyl-CoA dehydrogenase [Elaeis oleifera] Length = 212 Score = 92.4 bits (228), Expect = 3e-17 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = +3 Query: 87 MEGVDHLDHERRKAQFDVEAMKIVWAGSKHDLVVSDRMARLVASDPVFEKDNRQRIDR 260 ME VDHL HER KAQFDV+AMK+VWAGSKH L VSDRMARLVASDPVF KD+R + R Sbjct: 1 MEEVDHLAHERSKAQFDVDAMKVVWAGSKHALDVSDRMARLVASDPVFRKDDRTMLGR 58 >ref|XP_002868103.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata subsp. lyrata] gi|297313939|gb|EFH44362.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata subsp. lyrata] Length = 664 Score = 91.3 bits (225), Expect = 8e-17 Identities = 44/58 (75%), Positives = 48/58 (82%) Frame = +3 Query: 87 MEGVDHLDHERRKAQFDVEAMKIVWAGSKHDLVVSDRMARLVASDPVFEKDNRQRIDR 260 MEGVDHL ER KA+FDVE MKIVWAGS+H VSDR+ARLVASDPVFEK NR R+ R Sbjct: 1 MEGVDHLADERNKAEFDVEEMKIVWAGSRHAFEVSDRIARLVASDPVFEKSNRARLSR 58 >emb|CAB10450.1| acyl-CoA oxidase like protein [Arabidopsis thaliana] gi|7268426|emb|CAB78718.1| acyl-CoA oxidase like protein [Arabidopsis thaliana] Length = 895 Score = 90.9 bits (224), Expect = 1e-16 Identities = 44/61 (72%), Positives = 49/61 (80%) Frame = +3 Query: 78 LGAMEGVDHLDHERRKAQFDVEAMKIVWAGSKHDLVVSDRMARLVASDPVFEKDNRQRID 257 L MEG+DHL ER KA+FDVE MKIVWAGS+H VSDR+ARLVASDPVFEK NR R+ Sbjct: 211 LRIMEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLVASDPVFEKSNRARLS 270 Query: 258 R 260 R Sbjct: 271 R 271 >pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 gi|58177067|pdb|1W07|B Chain B, Arabidopsis Thaliana Acyl-Coa Oxidase 1 Length = 659 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = +3 Query: 87 MEGVDHLDHERRKAQFDVEAMKIVWAGSKHDLVVSDRMARLVASDPVFEKDNRQRIDR 260 MEG+DHL ER KA+FDVE MKIVWAGS+H VSDR+ARLVASDPVFEK NR R+ R Sbjct: 1 MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLVASDPVFEKSNRARLSR 58 >ref|NP_567513.4| peroxisomal acyl-coenzyme A oxidase 1 [Arabidopsis thaliana] gi|62286589|sp|O65202.1|ACOX1_ARATH RecName: Full=Peroxisomal acyl-coenzyme A oxidase 1; Short=AOX 1; AltName: Full=Long-chain acyl-CoA oxidase; Short=AtCX1 gi|3044214|gb|AAC13498.1| acyl-CoA oxidase [Arabidopsis thaliana] gi|16604462|gb|AAL24237.1| AT4g16760/dl4405c [Arabidopsis thaliana] gi|24111395|gb|AAN46824.1| At4g16760/dl4405c [Arabidopsis thaliana] gi|332658398|gb|AEE83798.1| peroxisomal acyl-coenzyme A oxidase 1 [Arabidopsis thaliana] Length = 664 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = +3 Query: 87 MEGVDHLDHERRKAQFDVEAMKIVWAGSKHDLVVSDRMARLVASDPVFEKDNRQRIDR 260 MEG+DHL ER KA+FDVE MKIVWAGS+H VSDR+ARLVASDPVFEK NR R+ R Sbjct: 1 MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLVASDPVFEKSNRARLSR 58