BLASTX nr result
ID: Dioscorea21_contig00015644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00015644 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis] 74 1e-11 ref|XP_002513755.1| Low-molecular-weight cysteine-rich protein L... 73 3e-11 ref|XP_002274353.1| PREDICTED: defensin-like protein [Vitis vini... 73 3e-11 gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa] 71 8e-11 gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha c... 70 1e-10 >gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis] Length = 77 Score = 74.3 bits (181), Expect = 1e-11 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = -3 Query: 417 LMISSGTVMVVEGRTCESQSHKFKGTCLRESNCANVCKTEGFHGG 283 LM S V E RTCESQSHKF+GTCLRESNCANVC+TEGF GG Sbjct: 18 LMPSEMGTKVAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGG 62 >ref|XP_002513755.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative [Ricinus communis] gi|223546841|gb|EEF48338.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative [Ricinus communis] Length = 77 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 390 VVEGRTCESQSHKFKGTCLRESNCANVCKTEGFHGG 283 V E RTCESQSHKFKGTCL +NCAN+CKTEGFHGG Sbjct: 27 VAEARTCESQSHKFKGTCLSTTNCANICKTEGFHGG 62 >ref|XP_002274353.1| PREDICTED: defensin-like protein [Vitis vinifera] gi|297738306|emb|CBI27507.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 393 MVVEGRTCESQSHKFKGTCLRESNCANVCKTEGFHGG 283 MV E RTCESQSH+FKGTC+R+SNCA VC+TEGFHGG Sbjct: 26 MVAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGG 62 >gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa] Length = 78 Score = 71.2 bits (173), Expect = 8e-11 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -3 Query: 393 MVVEGRTCESQSHKFKGTCLRESNCANVCKTEGFHGG 283 MV E RTCESQSH+FKG C+R+SNCA+VC+TEGFHGG Sbjct: 27 MVAEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGG 63 >gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas] Length = 77 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 390 VVEGRTCESQSHKFKGTCLRESNCANVCKTEGFHGG 283 + E RTCESQSHKFKGTCL E+NCANVCKTEGF GG Sbjct: 27 MAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGG 62