BLASTX nr result
ID: Dioscorea21_contig00015211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00015211 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003571089.1| PREDICTED: nuclear pore complex protein Nup2... 57 1e-06 ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup2... 56 3e-06 emb|CBI28192.3| unnamed protein product [Vitis vinifera] 56 3e-06 gb|EEE56517.1| hypothetical protein OsJ_05800 [Oryza sativa Japo... 55 6e-06 >ref|XP_003571089.1| PREDICTED: nuclear pore complex protein Nup205-like [Brachypodium distachyon] Length = 1824 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +1 Query: 103 EDLSLLCGRLLPILERLEQLREDKMGHGLNLLHRAVAVLKEVSIRNMA 246 +D+S LLPILERLE L+EDK+G L L HR+V LKE+++R+M+ Sbjct: 1776 KDMSSFSDELLPILERLEHLKEDKVGRNLKLFHRSVTTLKELAVRSMS 1823 >ref|XP_003633105.1| PREDICTED: nuclear pore complex protein Nup205-like [Vitis vinifera] Length = 1934 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = +1 Query: 85 NKTGANEDLSLLCGRLLPILERLEQLREDKMGHGLNLLHRAVAVLKEVSIRNM 243 +K +D+S+ CG+L+P LERLE L EDK+GH L + R V+ LKE+ I+ + Sbjct: 1880 DKFDNGQDISVFCGKLIPTLERLELLSEDKVGHNLKVFRRLVSSLKELGIQKL 1932 >emb|CBI28192.3| unnamed protein product [Vitis vinifera] Length = 1889 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = +1 Query: 85 NKTGANEDLSLLCGRLLPILERLEQLREDKMGHGLNLLHRAVAVLKEVSIRNM 243 +K +D+S+ CG+L+P LERLE L EDK+GH L + R V+ LKE+ I+ + Sbjct: 1835 DKFDNGQDISVFCGKLIPTLERLELLSEDKVGHNLKVFRRLVSSLKELGIQKL 1887 >gb|EEE56517.1| hypothetical protein OsJ_05800 [Oryza sativa Japonica Group] Length = 1961 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 103 EDLSLLCGRLLPILERLEQLREDKMGHGLNLLHRAVAVLKEVSIRNMA 246 +D+S LLPILERLE EDK+G L L HR+V LKE++IR+M+ Sbjct: 1913 KDISSFSDELLPILERLEHFTEDKVGRSLKLFHRSVTTLKEMTIRSMS 1960