BLASTX nr result
ID: Dioscorea21_contig00014907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00014907 (1253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62857.1| hypothetical protein VITISV_013427 [Vitis vinifera] 57 8e-06 >emb|CAN62857.1| hypothetical protein VITISV_013427 [Vitis vinifera] Length = 1392 Score = 57.4 bits (137), Expect = 8e-06 Identities = 42/130 (32%), Positives = 62/130 (47%), Gaps = 2/130 (1%) Frame = -1 Query: 1061 FQRLRELHIELCPRLTHLFSYKQAISMQHLSDLYIRDCAALEAVVISMENKEEAFASTST 882 F +L E+++ C +L ++F +Q L L DC++LEAV + + Sbjct: 1023 FSKLEEVNVSSCGQLLNIFPSCMLKRLQSLGLLRAADCSSLEAVF-------DVEGTNVN 1075 Query: 881 FVVDHEFYNSP--FPNLTRLFLYDLPQLTAIHHPAAVPIDWLYLERSWVLQCPKLQHPLF 708 VDH + FP +T LFL +LPQL + +P A W LE+ V C KL +F Sbjct: 1076 VNVDHSSLGNTFVFPKVTSLFLRNLPQLRSF-YPKAHTSQWPLLEQLMVYDCHKLN--VF 1132 Query: 707 GPRTPAHEQR 678 TP +QR Sbjct: 1133 AFETPTFQQR 1142