BLASTX nr result
ID: Dioscorea21_contig00014688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00014688 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABO26299.1| polyprotein [Nicotiana tabacum] 55 6e-06 >gb|ABO26299.1| polyprotein [Nicotiana tabacum] Length = 57 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = -2 Query: 314 RYHYIIIASEDGVLMLEKIFGNQNPADMLTKLVATIKFRYCLDLISV 174 RYH++ E+G + ++KI +NPADMLTK+V +KF++CLDLI++ Sbjct: 8 RYHFVREIIEEGGVTVKKIHTTENPADMLTKVVIAVKFQHCLDLINI 54