BLASTX nr result
ID: Dioscorea21_contig00014543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00014543 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002862660.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyra... 62 6e-08 gb|AAC83043.1| Similar to gb|AF067141 gamma-glutamyl hydrolase f... 60 1e-07 ref|NP_849900.1| gamma-glutamyl hydrolase 1 [Arabidopsis thalian... 60 1e-07 ref|NP_177987.1| gamma-glutamyl hydrolase 1 [Arabidopsis thalian... 60 1e-07 ref|XP_002887752.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyra... 60 2e-07 >ref|XP_002862660.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] gi|297308311|gb|EFH38918.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] Length = 347 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 289 PDPVKLLSHLIYNYKPTYGGYAGKGYDEVYIFT 191 PD K+LS+LIYNYKPTY GYAG GYDEVYIFT Sbjct: 309 PDSKKVLSYLIYNYKPTYCGYAGNGYDEVYIFT 341 >gb|AAC83043.1| Similar to gb|AF067141 gamma-glutamyl hydrolase from Arabidopsis thaliana; the beginning of this gene is cut off. ESTs gb|H76503 and gb|AA712367 come from this gene, partial [Arabidopsis thaliana] Length = 98 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 289 PDPVKLLSHLIYNYKPTYGGYAGKGYDEVYIFT 191 P+ K+LS+LIYNYKPTY GYAG+GYDEVYIFT Sbjct: 60 PESQKVLSNLIYNYKPTYCGYAGRGYDEVYIFT 92 >ref|NP_849900.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana] gi|89000971|gb|ABD59075.1| At1g78660 [Arabidopsis thaliana] gi|222423834|dbj|BAH19882.1| AT1G78660 [Arabidopsis thaliana] gi|332198013|gb|AEE36134.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana] Length = 347 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 289 PDPVKLLSHLIYNYKPTYGGYAGKGYDEVYIFT 191 P+ K+LS+LIYNYKPTY GYAG+GYDEVYIFT Sbjct: 309 PESQKVLSNLIYNYKPTYCGYAGRGYDEVYIFT 341 >ref|NP_177987.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana] gi|42572163|ref|NP_974172.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana] gi|4836867|gb|AAD30570.1|AC007260_1 putative gamma-glutamyl hydrolase [Arabidopsis thaliana] gi|332198012|gb|AEE36133.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana] gi|332198014|gb|AEE36135.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana] Length = 348 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 289 PDPVKLLSHLIYNYKPTYGGYAGKGYDEVYIFT 191 P+ K+LS+LIYNYKPTY GYAG+GYDEVYIFT Sbjct: 310 PESQKVLSNLIYNYKPTYCGYAGRGYDEVYIFT 342 >ref|XP_002887752.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] gi|297333593|gb|EFH64011.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] Length = 343 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 289 PDPVKLLSHLIYNYKPTYGGYAGKGYDEVYIFT 191 PD K+LS+LIY+YKPTY GYAG GYDEVYIFT Sbjct: 309 PDSKKVLSYLIYSYKPTYCGYAGNGYDEVYIFT 341