BLASTX nr result
ID: Dioscorea21_contig00014378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00014378 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003573137.1| PREDICTED: uncharacterized protein LOC100834... 56 3e-06 >ref|XP_003573137.1| PREDICTED: uncharacterized protein LOC100834932 [Brachypodium distachyon] Length = 1115 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/43 (58%), Positives = 30/43 (69%), Gaps = 4/43 (9%) Frame = -1 Query: 194 LEQLF----IDSGLHDHLHHLKIPHPSHGQRYGDIEGSWSPAY 78 +EQLF DSG+ D L HL +P PSH QRYGD++ WSPAY Sbjct: 174 VEQLFGIGGNDSGIPDSLRHLNVPRPSHSQRYGDMDSPWSPAY 216