BLASTX nr result
ID: Dioscorea21_contig00014333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00014333 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG50828.1|AC074395_2 clathrin heavy chain, putative [Arabido... 158 5e-37 gb|AAG51341.1|AC012562_2 putative clathrin heavy chain, 3' parti... 158 5e-37 ref|NP_187466.4| Clathrin, heavy chain [Arabidopsis thaliana] gi... 158 5e-37 ref|XP_004138417.1| PREDICTED: clathrin heavy chain 1-like [Cucu... 157 7e-37 gb|AGC82051.1| clathrin heavy chain 1 [Zea mays] 157 7e-37 >gb|AAG50828.1|AC074395_2 clathrin heavy chain, putative [Arabidopsis thaliana] Length = 1516 Score = 158 bits (399), Expect = 5e-37 Identities = 75/76 (98%), Positives = 76/76 (100%) Frame = +3 Query: 3 KLPDARPLINVCDRFNFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 182 KLPDARPLINVCDRF+FVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE Sbjct: 594 KLPDARPLINVCDRFSFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 653 Query: 183 DFIKGLILSVRSLLPV 230 DFIKGLILSVRSLLPV Sbjct: 654 DFIKGLILSVRSLLPV 669 >gb|AAG51341.1|AC012562_2 putative clathrin heavy chain, 3' partial; 6334-1 [Arabidopsis thaliana] Length = 1280 Score = 158 bits (399), Expect = 5e-37 Identities = 75/76 (98%), Positives = 76/76 (100%) Frame = +3 Query: 3 KLPDARPLINVCDRFNFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 182 KLPDARPLINVCDRF+FVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE Sbjct: 781 KLPDARPLINVCDRFSFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 840 Query: 183 DFIKGLILSVRSLLPV 230 DFIKGLILSVRSLLPV Sbjct: 841 DFIKGLILSVRSLLPV 856 >ref|NP_187466.4| Clathrin, heavy chain [Arabidopsis thaliana] gi|122223626|sp|Q0WLB5.1|CLAH2_ARATH RecName: Full=Clathrin heavy chain 2 gi|110740394|dbj|BAF02092.1| hypothetical protein [Arabidopsis thaliana] gi|332641123|gb|AEE74644.1| Clathrin, heavy chain [Arabidopsis thaliana] Length = 1703 Score = 158 bits (399), Expect = 5e-37 Identities = 75/76 (98%), Positives = 76/76 (100%) Frame = +3 Query: 3 KLPDARPLINVCDRFNFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 182 KLPDARPLINVCDRF+FVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE Sbjct: 781 KLPDARPLINVCDRFSFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 840 Query: 183 DFIKGLILSVRSLLPV 230 DFIKGLILSVRSLLPV Sbjct: 841 DFIKGLILSVRSLLPV 856 >ref|XP_004138417.1| PREDICTED: clathrin heavy chain 1-like [Cucumis sativus] gi|449499116|ref|XP_004160726.1| PREDICTED: clathrin heavy chain 1-like [Cucumis sativus] Length = 1707 Score = 157 bits (398), Expect = 7e-37 Identities = 75/76 (98%), Positives = 75/76 (98%) Frame = +3 Query: 3 KLPDARPLINVCDRFNFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 182 KLPDARPLINVCDRF FVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE Sbjct: 781 KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 840 Query: 183 DFIKGLILSVRSLLPV 230 DFIKGLILSVRSLLPV Sbjct: 841 DFIKGLILSVRSLLPV 856 >gb|AGC82051.1| clathrin heavy chain 1 [Zea mays] Length = 1693 Score = 157 bits (398), Expect = 7e-37 Identities = 75/76 (98%), Positives = 75/76 (98%) Frame = +3 Query: 3 KLPDARPLINVCDRFNFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 182 KLPDARPLINVCDRF FVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE Sbjct: 772 KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE 831 Query: 183 DFIKGLILSVRSLLPV 230 DFIKGLILSVRSLLPV Sbjct: 832 DFIKGLILSVRSLLPV 847