BLASTX nr result
ID: Dioscorea21_contig00014039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00014039 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530987.1| conserved hypothetical protein [Ricinus comm... 83 2e-14 gb|AFM52663.1| putative NAD-dependent dehydrogenase 2 [Erythroxy... 82 5e-14 ref|XP_004167131.1| PREDICTED: uncharacterized protein At2g37660... 81 8e-14 ref|XP_004142064.1| PREDICTED: uncharacterized protein At2g37660... 81 8e-14 gb|AFK40676.1| unknown [Lotus japonicus] 80 1e-13 >ref|XP_002530987.1| conserved hypothetical protein [Ricinus communis] gi|223529439|gb|EEF31399.1| conserved hypothetical protein [Ricinus communis] Length = 323 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/42 (90%), Positives = 42/42 (100%) Frame = +3 Query: 3 CIQALQFEEAKFKAFDLASKPEGSGTPTKDFKALFAQITTRF 128 CIQALQFEEAKFKAFDLASKPEG+G+PTKDFKALF+Q+TTRF Sbjct: 282 CIQALQFEEAKFKAFDLASKPEGTGSPTKDFKALFSQVTTRF 323 >gb|AFM52663.1| putative NAD-dependent dehydrogenase 2 [Erythroxylum coca] Length = 253 Score = 82.0 bits (201), Expect = 5e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIQALQFEEAKFKAFDLASKPEGSGTPTKDFKALFAQITTRF 128 CIQALQ+EEAKFKAFDLASKPEG+GTPTKDFKALF+QIT RF Sbjct: 212 CIQALQYEEAKFKAFDLASKPEGTGTPTKDFKALFSQITARF 253 >ref|XP_004167131.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like, partial [Cucumis sativus] Length = 236 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 3 CIQALQFEEAKFKAFDLASKPEGSGTPTKDFKALFAQITTRF 128 CIQALQFEEAKFKA DLASKPEG GTPTKDFKALF+Q+TTRF Sbjct: 195 CIQALQFEEAKFKALDLASKPEGVGTPTKDFKALFSQVTTRF 236 >ref|XP_004142064.1| PREDICTED: uncharacterized protein At2g37660, chloroplastic-like [Cucumis sativus] Length = 326 Score = 81.3 bits (199), Expect = 8e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 3 CIQALQFEEAKFKAFDLASKPEGSGTPTKDFKALFAQITTRF 128 CIQALQFEEAKFKA DLASKPEG GTPTKDFKALF+Q+TTRF Sbjct: 285 CIQALQFEEAKFKALDLASKPEGVGTPTKDFKALFSQVTTRF 326 >gb|AFK40676.1| unknown [Lotus japonicus] Length = 313 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 3 CIQALQFEEAKFKAFDLASKPEGSGTPTKDFKALFAQITTRF 128 CIQAL FEEA+FKAFDLASKPEG+GTPT+DFKALF+QITTRF Sbjct: 272 CIQALNFEEAQFKAFDLASKPEGAGTPTRDFKALFSQITTRF 313