BLASTX nr result
ID: Dioscorea21_contig00012340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00012340 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW63023.1| putative cytochrome P450 superfamily protein [Zea... 59 4e-07 ref|NP_001146311.1| uncharacterized protein LOC100279887 [Zea ma... 59 4e-07 gb|ACG38346.1| flavonoid 3-monooxygenase [Zea mays] 59 4e-07 gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana] 59 5e-07 ref|XP_002319761.1| flavonoid 3'-hydroxylase [Populus trichocarp... 59 5e-07 >gb|AFW63023.1| putative cytochrome P450 superfamily protein [Zea mays] gi|413949557|gb|AFW82206.1| putative cytochrome P450 superfamily protein [Zea mays] Length = 535 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -2 Query: 245 FDWDLPDGLTPETLNLDVEFGLTLERSVPLVARPIPRLNHEAY 117 FDW+LP G TP+ LN++ F L L+R+VPLVARP+PRL AY Sbjct: 490 FDWELPAGQTPDKLNMEEAFTLLLQRAVPLVARPVPRLLPSAY 532 >ref|NP_001146311.1| uncharacterized protein LOC100279887 [Zea mays] gi|219886591|gb|ACL53670.1| unknown [Zea mays] Length = 535 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -2 Query: 245 FDWDLPDGLTPETLNLDVEFGLTLERSVPLVARPIPRLNHEAY 117 FDW+LP G TP+ LN++ F L L+R+VPLVARP+PRL AY Sbjct: 490 FDWELPAGQTPDKLNMEEAFTLLLQRAVPLVARPVPRLLPSAY 532 >gb|ACG38346.1| flavonoid 3-monooxygenase [Zea mays] Length = 535 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -2 Query: 245 FDWDLPDGLTPETLNLDVEFGLTLERSVPLVARPIPRLNHEAY 117 FDW+LP G TP+ LN++ F L L+R+VPLVARP+PRL AY Sbjct: 490 FDWELPAGQTPDKLNMEEAFTLLLQRAVPLVARPVPRLLPSAY 532 >gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana] Length = 507 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -2 Query: 245 FDWDLPDGLTPETLNLDVEFGLTLERSVPLVARPIPRLNHEAYVA 111 FDW+L +GL PE LN+D +GLTL+R+ PL+ P PRL+ +AY A Sbjct: 461 FDWELANGLIPEKLNMDEAYGLTLQRAAPLMVHPKPRLSPQAYKA 505 >ref|XP_002319761.1| flavonoid 3'-hydroxylase [Populus trichocarpa] gi|222858137|gb|EEE95684.1| flavonoid 3'-hydroxylase [Populus trichocarpa] Length = 521 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -2 Query: 245 FDWDLPDGLTPETLNLDVEFGLTLERSVPLVARPIPRLNHEAY 117 FDWDL DGL PE LN+D +GLTL+R+ PL+ P PRL+ + Y Sbjct: 475 FDWDLADGLVPEKLNMDEAYGLTLQRADPLMVHPRPRLSPKVY 517