BLASTX nr result
ID: Dioscorea21_contig00012154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00012154 (575 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529814.1| PREDICTED: WD repeat-containing protein 43-l... 82 5e-14 ref|XP_002517583.1| conserved hypothetical protein [Ricinus comm... 82 8e-14 ref|XP_002304157.1| predicted protein [Populus trichocarpa] gi|2... 81 1e-13 gb|AFW79002.1| hypothetical protein ZEAMMB73_383322 [Zea mays] g... 79 4e-13 ref|XP_003533062.1| PREDICTED: WD repeat-containing protein 43-l... 78 1e-12 >ref|XP_003529814.1| PREDICTED: WD repeat-containing protein 43-like [Glycine max] Length = 622 Score = 82.4 bits (202), Expect = 5e-14 Identities = 44/67 (65%), Positives = 51/67 (76%), Gaps = 1/67 (1%) Frame = +2 Query: 377 DINEPTMEEKLASLDLANSEMVKS-ISKDISPMTKLPSADSVHVLLKQALNADDHVLLLD 553 D+NEPTM EKLASL L + +S I ++ S K PSADSVHVLLKQALNADD LLLD Sbjct: 407 DLNEPTMGEKLASLSLLDENKSRSEIEQESSVPAKPPSADSVHVLLKQALNADDRTLLLD 466 Query: 554 CLYTRDK 574 CLYT+D+ Sbjct: 467 CLYTQDE 473 >ref|XP_002517583.1| conserved hypothetical protein [Ricinus communis] gi|223543215|gb|EEF44747.1| conserved hypothetical protein [Ricinus communis] Length = 634 Score = 81.6 bits (200), Expect = 8e-14 Identities = 46/91 (50%), Positives = 63/91 (69%), Gaps = 1/91 (1%) Frame = +2 Query: 305 APDLDDTSGGNLHSELMLEEAAQFDINEPTMEEKLASLDLANSEMVKSISKDISPM-TKL 481 AP DT G + +++E+ D+NEPTM EKLASL+L +++ K K SP K Sbjct: 393 APGDVDTENGEAMNGVLVED----DVNEPTMGEKLASLNLQDNDKTKDQEKPESPPHAKP 448 Query: 482 PSADSVHVLLKQALNADDHVLLLDCLYTRDK 574 PSADSV++LLKQAL+A+D LLLDCLYT+++ Sbjct: 449 PSADSVNILLKQALHAEDRALLLDCLYTQNE 479 >ref|XP_002304157.1| predicted protein [Populus trichocarpa] gi|222841589|gb|EEE79136.1| predicted protein [Populus trichocarpa] Length = 247 Score = 81.3 bits (199), Expect = 1e-13 Identities = 46/93 (49%), Positives = 61/93 (65%), Gaps = 3/93 (3%) Frame = +2 Query: 305 APDLDDT--SGGNLHSELMLEEAAQFDINEPTMEEKLASLDLANSEMVKSISKDISPM-T 475 A D+ DT +G + H ++D+NEPTM EKLAS+ L ++ S+ + SP Sbjct: 10 ASDVGDTIDTGMDYHGAATDGVLVEYDVNEPTMGEKLASITLQDNGKTNSLEIEESPPHA 69 Query: 476 KLPSADSVHVLLKQALNADDHVLLLDCLYTRDK 574 K PSADSV++LLKQAL ADD LLLDCLYT+D+ Sbjct: 70 KPPSADSVNILLKQALRADDRALLLDCLYTQDE 102 >gb|AFW79002.1| hypothetical protein ZEAMMB73_383322 [Zea mays] gi|413946354|gb|AFW79003.1| hypothetical protein ZEAMMB73_383322 [Zea mays] Length = 268 Score = 79.3 bits (194), Expect = 4e-13 Identities = 44/87 (50%), Positives = 59/87 (67%) Frame = +2 Query: 314 LDDTSGGNLHSELMLEEAAQFDINEPTMEEKLASLDLANSEMVKSISKDISPMTKLPSAD 493 LD T N+ ++ EE ++++++EPTMEEKLA+L+L N E ++ S PSAD Sbjct: 35 LDST---NVSDTVISEEMSEYNLDEPTMEEKLATLNLINRENEIHGTEKQSLSVAPPSAD 91 Query: 494 SVHVLLKQALNADDHVLLLDCLYTRDK 574 SVH+LLKQAL ADD V LL CLY RD+ Sbjct: 92 SVHILLKQALRADDSVALLTCLYNRDE 118 >ref|XP_003533062.1| PREDICTED: WD repeat-containing protein 43-like [Glycine max] Length = 620 Score = 77.8 bits (190), Expect = 1e-12 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 1/67 (1%) Frame = +2 Query: 377 DINEPTMEEKLASLDLANSEMVKSISKDISPM-TKLPSADSVHVLLKQALNADDHVLLLD 553 D+NEPTM EKLASL + + +S ++ S + K PSADSVHVLLKQALNADD LLLD Sbjct: 407 DLNEPTMGEKLASLSVLDGNKSRSDTEQESSVPAKPPSADSVHVLLKQALNADDRTLLLD 466 Query: 554 CLYTRDK 574 CL+T+D+ Sbjct: 467 CLFTQDE 473