BLASTX nr result
ID: Dioscorea21_contig00012103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00012103 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325811.1| predicted protein [Populus trichocarpa] gi|2... 125 3e-27 ref|XP_002520842.1| uroporphyrinogen decarboxylase, putative [Ri... 123 1e-26 ref|XP_002467895.1| hypothetical protein SORBIDRAFT_01g036030 [S... 123 2e-26 gb|ACF81966.1| unknown [Zea mays] gi|414866701|tpg|DAA45258.1| T... 123 2e-26 ref|NP_001105610.1| uroporphyrinogen decarboxylase, chloroplasti... 123 2e-26 >ref|XP_002325811.1| predicted protein [Populus trichocarpa] gi|222862686|gb|EEF00193.1| predicted protein [Populus trichocarpa] Length = 403 Score = 125 bits (315), Expect = 3e-27 Identities = 61/72 (84%), Positives = 69/72 (95%) Frame = +2 Query: 2 SDILTPLSGMNIPFDIVKGKGPVIYSPLRTSGDVDQVREFVPEEFVPYVGEALSILRDEV 181 SDILTPLSGMNIPFDIVKGKGPVI++PLRT+ DVDQVREFVPEE VPYVGEAL++LR EV Sbjct: 132 SDILTPLSGMNIPFDIVKGKGPVIFNPLRTADDVDQVREFVPEESVPYVGEALTVLRKEV 191 Query: 182 KDEAAVLGFVGA 217 +++AAVLGFVGA Sbjct: 192 ENKAAVLGFVGA 203 >ref|XP_002520842.1| uroporphyrinogen decarboxylase, putative [Ricinus communis] gi|223539973|gb|EEF41551.1| uroporphyrinogen decarboxylase, putative [Ricinus communis] Length = 389 Score = 123 bits (309), Expect = 1e-26 Identities = 60/72 (83%), Positives = 68/72 (94%) Frame = +2 Query: 2 SDILTPLSGMNIPFDIVKGKGPVIYSPLRTSGDVDQVREFVPEEFVPYVGEALSILRDEV 181 SDILTPLSGMNIPFDIVKGKGP+I++PLRT+ DVDQVREFVPEE VPYVGE+L+ILR EV Sbjct: 118 SDILTPLSGMNIPFDIVKGKGPIIFNPLRTAEDVDQVREFVPEESVPYVGESLTILRKEV 177 Query: 182 KDEAAVLGFVGA 217 ++AAVLGFVGA Sbjct: 178 DNKAAVLGFVGA 189 >ref|XP_002467895.1| hypothetical protein SORBIDRAFT_01g036030 [Sorghum bicolor] gi|241921749|gb|EER94893.1| hypothetical protein SORBIDRAFT_01g036030 [Sorghum bicolor] Length = 394 Score = 123 bits (308), Expect = 2e-26 Identities = 59/72 (81%), Positives = 68/72 (94%) Frame = +2 Query: 2 SDILTPLSGMNIPFDIVKGKGPVIYSPLRTSGDVDQVREFVPEEFVPYVGEALSILRDEV 181 SDILTPL GMNIPFDIVKGKGPVIY PLRT+ V++VREFVPEE+VPYVG+AL++LR+EV Sbjct: 123 SDILTPLPGMNIPFDIVKGKGPVIYDPLRTAAAVNEVREFVPEEWVPYVGQALNLLREEV 182 Query: 182 KDEAAVLGFVGA 217 K+EAAVLGFVGA Sbjct: 183 KNEAAVLGFVGA 194 >gb|ACF81966.1| unknown [Zea mays] gi|414866701|tpg|DAA45258.1| TPA: lesion22 isoform 1 [Zea mays] gi|414866702|tpg|DAA45259.1| TPA: lesion22 isoform 2 [Zea mays] Length = 394 Score = 123 bits (308), Expect = 2e-26 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = +2 Query: 2 SDILTPLSGMNIPFDIVKGKGPVIYSPLRTSGDVDQVREFVPEEFVPYVGEALSILRDEV 181 SDILTPL GMNIPFDIVKGKGPVIY PLRT+ V++VREFVPEE+VPYVG+AL+ILR EV Sbjct: 123 SDILTPLPGMNIPFDIVKGKGPVIYDPLRTAAAVNEVREFVPEEWVPYVGQALNILRQEV 182 Query: 182 KDEAAVLGFVGA 217 K+EAAVLGFVGA Sbjct: 183 KNEAAVLGFVGA 194 >ref|NP_001105610.1| uroporphyrinogen decarboxylase, chloroplastic [Zea mays] gi|6014938|sp|O81220.1|DCUP_MAIZE RecName: Full=Uroporphyrinogen decarboxylase, chloroplastic; Short=UPD; Short=URO-D; Flags: Precursor gi|3420233|gb|AAC31883.1| uroporphyrinogen decarboxylase [Zea mays] Length = 393 Score = 123 bits (308), Expect = 2e-26 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = +2 Query: 2 SDILTPLSGMNIPFDIVKGKGPVIYSPLRTSGDVDQVREFVPEEFVPYVGEALSILRDEV 181 SDILTPL GMNIPFDIVKGKGPVIY PLRT+ V++VREFVPEE+VPYVG+AL+ILR EV Sbjct: 122 SDILTPLPGMNIPFDIVKGKGPVIYDPLRTAAAVNEVREFVPEEWVPYVGQALNILRQEV 181 Query: 182 KDEAAVLGFVGA 217 K+EAAVLGFVGA Sbjct: 182 KNEAAVLGFVGA 193