BLASTX nr result
ID: Dioscorea21_contig00011139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00011139 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533013.1| conserved hypothetical protein [Ricinus comm... 45 2e-08 ref|XP_002533009.1| hypothetical protein RCOM_1170110 [Ricinus c... 40 2e-07 >ref|XP_002533013.1| conserved hypothetical protein [Ricinus communis] gi|223527202|gb|EEF29367.1| conserved hypothetical protein [Ricinus communis] Length = 1031 Score = 45.4 bits (106), Expect(2) = 2e-08 Identities = 24/49 (48%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +2 Query: 74 FVDSSQRSLLACTRSSSGGDC--LKDSNITMVELKNTTWVDKTYSIFPS 214 F+D SQ++L C ++SS DC L +SN TM EL++ TW D YSI S Sbjct: 323 FIDHSQKNL-GCKKNSSSVDCTSLAESNFTMHELRDITWEDNPYSILSS 370 Score = 38.1 bits (87), Expect(2) = 2e-08 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 1 VCGLNSYCSLVDDGVVCLCPRGFDF 75 +CGLNSYC+L C+C GFDF Sbjct: 299 LCGLNSYCTLAGGSPTCVCTPGFDF 323 >ref|XP_002533009.1| hypothetical protein RCOM_1170110 [Ricinus communis] gi|223527198|gb|EEF29363.1| hypothetical protein RCOM_1170110 [Ricinus communis] Length = 696 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 Query: 1 VCGLNSYCSLVDDGVVCLCPRGFDF 75 +CGLNSYC+LVD C+C GF+F Sbjct: 270 LCGLNSYCTLVDQDSACICLPGFEF 294 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +2 Query: 74 FVDSSQRSLLACTRSSSGGDCL--KDSNITMVELKNTTWVDKTYSIFPS 214 FVD Q +L C R+S+ DC+ ++SN+TM EL + +W D Y I S Sbjct: 294 FVDQGQENL-GCKRNSTLDDCISFRESNVTMQELTSISWEDDPYYILES 341