BLASTX nr result
ID: Dioscorea21_contig00010934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00010934 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like ... 141 5e-32 sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase... 140 8e-32 gb|ADP06659.1| phenylalanine ammonia lyase [Mangifera indica] 140 8e-32 emb|CAH17686.1| phenylalanine ammonia lyase [Beta vulgaris] 140 1e-31 ref|NP_187645.1| phenylalanine ammonia-lyase 4 [Arabidopsis thal... 140 1e-31 >ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus] gi|449482466|ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus] Length = 713 Score = 141 bits (356), Expect = 5e-32 Identities = 70/77 (90%), Positives = 74/77 (96%) Frame = -1 Query: 232 AMLVRINTLMQGYSGIRFEILEAITSLLNNQITPCLPLRGTITASGDLVPLSYIAGMLTG 53 AMLVRINTL+QGYSGIRFEILEAIT LLNN ITPCLPLRGTITASGDLVPLSYIAG+LTG Sbjct: 156 AMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 215 Query: 52 RPNSKAIGPDGETITAE 2 RPNSKAIGP+GE ITA+ Sbjct: 216 RPNSKAIGPNGERITAK 232 >sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase gi|556424|gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis] Length = 715 Score = 140 bits (354), Expect = 8e-32 Identities = 68/77 (88%), Positives = 74/77 (96%) Frame = -1 Query: 232 AMLVRINTLMQGYSGIRFEILEAITSLLNNQITPCLPLRGTITASGDLVPLSYIAGMLTG 53 AMLVRINTL+QGYSGIRFEILEAIT LLNN ITPCLPLRGTITASGDLVPLSYIAG+LTG Sbjct: 158 AMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 217 Query: 52 RPNSKAIGPDGETITAE 2 RPNSKA+GP+GET+ A+ Sbjct: 218 RPNSKAVGPNGETLNAK 234 >gb|ADP06659.1| phenylalanine ammonia lyase [Mangifera indica] Length = 151 Score = 140 bits (354), Expect = 8e-32 Identities = 70/77 (90%), Positives = 73/77 (94%) Frame = -1 Query: 232 AMLVRINTLMQGYSGIRFEILEAITSLLNNQITPCLPLRGTITASGDLVPLSYIAGMLTG 53 AMLVRINTL+QGYSGIRFEILEAITSLLNN ITPCLPLRGTITASGDLVPLSYIAG+LTG Sbjct: 67 AMLVRINTLLQGYSGIRFEILEAITSLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 126 Query: 52 RPNSKAIGPDGETITAE 2 RPNSKA GP+GE I AE Sbjct: 127 RPNSKATGPNGEIINAE 143 >emb|CAH17686.1| phenylalanine ammonia lyase [Beta vulgaris] Length = 719 Score = 140 bits (353), Expect = 1e-31 Identities = 68/77 (88%), Positives = 73/77 (94%) Frame = -1 Query: 232 AMLVRINTLMQGYSGIRFEILEAITSLLNNQITPCLPLRGTITASGDLVPLSYIAGMLTG 53 AMLVRINTL+QGYSGIRFEILEAIT LLNN ITPCLPLRGTITASGDLVPLSYIAG+LTG Sbjct: 162 AMLVRINTLLQGYSGIRFEILEAITGLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 221 Query: 52 RPNSKAIGPDGETITAE 2 RPNSKA+GP+GE + AE Sbjct: 222 RPNSKAVGPNGEVLNAE 238 >ref|NP_187645.1| phenylalanine ammonia-lyase 4 [Arabidopsis thaliana] gi|14195018|sp|Q9SS45.1|PAL4_ARATH RecName: Full=Phenylalanine ammonia-lyase 4 gi|6056192|gb|AAF02809.1|AC009400_5 putative phenylalanine ammonia-lyase [Arabidopsis thaliana] gi|20466382|gb|AAM20508.1| putative phenylalanine ammonia-lyase [Arabidopsis thaliana] gi|23198088|gb|AAN15571.1| putative phenylalanine ammonia-lyase [Arabidopsis thaliana] gi|32140425|gb|AAP59440.1| phenylalanine ammonia lyase [Arabidopsis thaliana] gi|332641372|gb|AEE74893.1| phenylalanine ammonia-lyase 4 [Arabidopsis thaliana] Length = 707 Score = 140 bits (353), Expect = 1e-31 Identities = 67/76 (88%), Positives = 74/76 (97%) Frame = -1 Query: 232 AMLVRINTLMQGYSGIRFEILEAITSLLNNQITPCLPLRGTITASGDLVPLSYIAGMLTG 53 AMLVR+NTL+QGYSGIRFEILEAIT LLN++ITPCLPLRGTITASGDLVPLSYIAG+LTG Sbjct: 151 AMLVRVNTLLQGYSGIRFEILEAITKLLNHEITPCLPLRGTITASGDLVPLSYIAGLLTG 210 Query: 52 RPNSKAIGPDGETITA 5 RPNSKA+GP GET+TA Sbjct: 211 RPNSKAVGPSGETLTA 226