BLASTX nr result
ID: Dioscorea21_contig00009995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00009995 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT08700.1| pollen-specific protein [Hyacinthus orientalis] 72 4e-11 ref|XP_002513885.1| Pollen-specific protein C13 precursor, putat... 70 2e-10 ref|NP_567338.1| protein SAH7 [Arabidopsis thaliana] gi|4584110|... 70 2e-10 gb|ABK92993.1| unknown [Populus trichocarpa] 70 2e-10 ref|XP_002301038.1| predicted protein [Populus trichocarpa] gi|1... 70 2e-10 >gb|AAT08700.1| pollen-specific protein [Hyacinthus orientalis] Length = 174 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/54 (55%), Positives = 44/54 (81%), Gaps = 2/54 (3%) Frame = +2 Query: 53 CYLPINVSAARNVPEK--NKFIVEGKVFCDSCQFGYETPLSTYLAGAKVRVECR 208 C +P+ VS +RN+ + + FIV+G+VFCD+C+ G+ETP +TY+AGAKVRVEC+ Sbjct: 22 CLMPVTVSGSRNIKKSGGSPFIVQGRVFCDTCRAGFETPATTYIAGAKVRVECK 75 >ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis] gi|223546971|gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis] Length = 159 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = +2 Query: 53 CYLPINVSAARNVPEKNKFIVEGKVFCDSCQFGYETPLSTYLAGAKVRVECRDK 214 C LP V+AAR P +N F VEG+V+CD+C+ G+ET +TY+AGAKVRVEC+D+ Sbjct: 11 CVLPALVAAAR--PARNPFEVEGRVYCDTCRAGFETSKTTYVAGAKVRVECKDR 62 >ref|NP_567338.1| protein SAH7 [Arabidopsis thaliana] gi|4584110|emb|CAB40579.1| SAH7 protein [Arabidopsis thaliana] gi|18491199|gb|AAL69502.1| unknown protein [Arabidopsis thaliana] gi|21280951|gb|AAM45117.1| unknown protein [Arabidopsis thaliana] gi|21553842|gb|AAM62935.1| allergen-like protein BRSn20 [Arabidopsis thaliana] gi|110737041|dbj|BAF00475.1| hypothetical protein [Arabidopsis thaliana] gi|332657268|gb|AEE82668.1| protein SAH7 [Arabidopsis thaliana] Length = 159 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +2 Query: 53 CYLPINVSAARNVPEKNKFIVEGKVFCDSCQFGYETPLSTYLAGAKVRVECRDK 214 C+LP AAR P KN F+V G+V+CD+C G+ETP STY++GA VR+EC+D+ Sbjct: 11 CFLPALAIAAR--PNKNPFVVRGRVYCDTCLAGFETPASTYISGAVVRLECKDR 62 >gb|ABK92993.1| unknown [Populus trichocarpa] Length = 159 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 53 CYLPINVSAARNVPEKNKFIVEGKVFCDSCQFGYETPLSTYLAGAKVRVECRDK 214 C LP VSAAR P +N F V+G V+CD+C G+ETP +TY+AG+KV+VECRD+ Sbjct: 11 CVLPALVSAAR--PGRNTFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDR 62 >ref|XP_002301038.1| predicted protein [Populus trichocarpa] gi|118482413|gb|ABK93129.1| unknown [Populus trichocarpa] gi|118485251|gb|ABK94485.1| unknown [Populus trichocarpa] gi|118487858|gb|ABK95752.1| unknown [Populus trichocarpa] gi|222842764|gb|EEE80311.1| predicted protein [Populus trichocarpa] Length = 159 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +2 Query: 53 CYLPINVSAARNVPEKNKFIVEGKVFCDSCQFGYETPLSTYLAGAKVRVECRDK 214 C LP VSAAR P +N F V+G V+CD+C G+ETP +TY+AG+KV+VECRD+ Sbjct: 11 CVLPALVSAAR--PGRNPFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDR 62