BLASTX nr result
ID: Dioscorea21_contig00009961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00009961 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS21018.1| autophagy protein AGP6 [Hyacinthus orientalis] 103 1e-20 ref|XP_002323492.1| predicted protein [Populus trichocarpa] gi|2... 102 4e-20 ref|XP_002326225.1| predicted protein [Populus trichocarpa] gi|2... 100 9e-20 ref|XP_002519434.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 ref|XP_002263868.1| PREDICTED: vacuolar protein-sorting-associat... 100 2e-19 >gb|AAS21018.1| autophagy protein AGP6 [Hyacinthus orientalis] Length = 176 Score = 103 bits (258), Expect = 1e-20 Identities = 48/73 (65%), Positives = 63/73 (86%) Frame = -3 Query: 275 EKQKEELLRSYSPSALLQKLHDAMDKVEGESEVLHRQLLEKEIDLATFVQKYKKLRTIYH 96 EKQK+E+LR YSP+++L+ L DAM+K E ESEVLH +L+EK+IDL TFVQKYKKLR YH Sbjct: 103 EKQKDEILRFYSPTSMLRNLQDAMNKTEEESEVLHNKLVEKDIDLVTFVQKYKKLRNTYH 162 Query: 95 RRSLLHLSARTTM 57 RR+L HL+A+T++ Sbjct: 163 RRALTHLAAKTSI 175 >ref|XP_002323492.1| predicted protein [Populus trichocarpa] gi|222868122|gb|EEF05253.1| predicted protein [Populus trichocarpa] Length = 230 Score = 102 bits (253), Expect = 4e-20 Identities = 47/72 (65%), Positives = 61/72 (84%) Frame = -3 Query: 275 EKQKEELLRSYSPSALLQKLHDAMDKVEGESEVLHRQLLEKEIDLATFVQKYKKLRTIYH 96 EKQKEELLRS SP+++LQ+L +AM+K E ES+ HRQ LEKE+DL FVQKYKKLRT YH Sbjct: 156 EKQKEELLRSCSPASILQRLQEAMNKTEEESDAFHRQFLEKEMDLGAFVQKYKKLRTTYH 215 Query: 95 RRSLLHLSARTT 60 +R+L+HL+A+ + Sbjct: 216 KRALIHLAAKAS 227 >ref|XP_002326225.1| predicted protein [Populus trichocarpa] gi|222833418|gb|EEE71895.1| predicted protein [Populus trichocarpa] Length = 233 Score = 100 bits (250), Expect = 9e-20 Identities = 47/72 (65%), Positives = 62/72 (86%) Frame = -3 Query: 275 EKQKEELLRSYSPSALLQKLHDAMDKVEGESEVLHRQLLEKEIDLATFVQKYKKLRTIYH 96 E+QKEELLRS SP++LLQ+L +AM+K + ESE LHRQ L+KEIDL +FV KYKKLRT YH Sbjct: 159 ERQKEELLRSCSPASLLQRLQEAMNKTDEESEALHRQFLDKEIDLGSFVLKYKKLRTTYH 218 Query: 95 RRSLLHLSARTT 60 +R+L+HL+A+ + Sbjct: 219 KRALIHLAAKAS 230 >ref|XP_002519434.1| conserved hypothetical protein [Ricinus communis] gi|223541297|gb|EEF42848.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 100 bits (248), Expect = 2e-19 Identities = 45/72 (62%), Positives = 63/72 (87%) Frame = -3 Query: 275 EKQKEELLRSYSPSALLQKLHDAMDKVEGESEVLHRQLLEKEIDLATFVQKYKKLRTIYH 96 EKQKEE+LRS SP++LLQ+L +A++K + ESE+LH+QLL++EI+L FVQKYKKLR YH Sbjct: 155 EKQKEEMLRSCSPASLLQRLQEAINKTDEESEILHKQLLDREIELLAFVQKYKKLRATYH 214 Query: 95 RRSLLHLSARTT 60 RR+L+HL+ +T+ Sbjct: 215 RRTLIHLAGKTS 226 >ref|XP_002263868.1| PREDICTED: vacuolar protein-sorting-associated protein 37 homolog 2 [Vitis vinifera] gi|297740010|emb|CBI30192.3| unnamed protein product [Vitis vinifera] Length = 233 Score = 99.8 bits (247), Expect = 2e-19 Identities = 45/72 (62%), Positives = 60/72 (83%) Frame = -3 Query: 275 EKQKEELLRSYSPSALLQKLHDAMDKVEGESEVLHRQLLEKEIDLATFVQKYKKLRTIYH 96 E+QKEE+L+ YSP+ LL +L + M+K E ESE LHRQLL++E+DL FVQKYK+LRT YH Sbjct: 159 ERQKEEILKFYSPACLLHRLQETMNKTEEESETLHRQLLDREMDLGAFVQKYKRLRTTYH 218 Query: 95 RRSLLHLSARTT 60 RR+L HL+A+T+ Sbjct: 219 RRALTHLAAKTS 230