BLASTX nr result
ID: Dioscorea21_contig00009122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00009122 (559 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002443570.1| hypothetical protein SORBIDRAFT_08g021750 [S... 55 6e-06 >ref|XP_002443570.1| hypothetical protein SORBIDRAFT_08g021750 [Sorghum bicolor] gi|241944263|gb|EES17408.1| hypothetical protein SORBIDRAFT_08g021750 [Sorghum bicolor] Length = 324 Score = 55.5 bits (132), Expect = 6e-06 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 4/71 (5%) Frame = -3 Query: 545 GQLPLASPKTKMISMSILVISLPVLYA--MHVPPSTLFTDTVFWFXXXXXXXXXIATDSG 372 GQ + +S+S+LV+SLPVLY +HVPP+ LF DT FWF IA DSG Sbjct: 16 GQSSKQQQLMRTVSISVLVMSLPVLYVSFLHVPPAALFRDTTFWFLMSNSIIIVIAADSG 75 Query: 371 V--FSTSSSEN 345 + F +SSS + Sbjct: 76 MLFFRSSSSSS 86