BLASTX nr result
ID: Dioscorea21_contig00009096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00009096 (500 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL99098.1| strictosidine synthase-like protein, partial [Sil... 77 2e-12 gb|AEL99097.1| strictosidine synthase-like protein, partial [Sil... 77 2e-12 ref|XP_004172338.1| PREDICTED: adipocyte plasma membrane-associa... 75 4e-12 ref|XP_004137361.1| PREDICTED: adipocyte plasma membrane-associa... 75 4e-12 dbj|BAE80094.1| strictosidine synthase family protein [Silene la... 74 9e-12 >gb|AEL99098.1| strictosidine synthase-like protein, partial [Silene latifolia] Length = 388 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 LQILEDRQGKVVRAVSEVEEKDGKLWLGSVLMPFIAVYDL 122 LQ+LEDR GKVV+AVSEVEEKDGKLW+GSVLMPFIAVYDL Sbjct: 349 LQVLEDRPGKVVKAVSEVEEKDGKLWIGSVLMPFIAVYDL 388 >gb|AEL99097.1| strictosidine synthase-like protein, partial [Silene latifolia] Length = 388 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 LQILEDRQGKVVRAVSEVEEKDGKLWLGSVLMPFIAVYDL 122 LQ+LEDR GKVV+AVSEVEEKDGKLW+GSVLMPFIAVYDL Sbjct: 349 LQVLEDRPGKVVKAVSEVEEKDGKLWIGSVLMPFIAVYDL 388 >ref|XP_004172338.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Cucumis sativus] Length = 402 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 3 LQILEDRQGKVVRAVSEVEEKDGKLWLGSVLMPFIAVYDLH 125 LQILED QGKVV+AVSEVEEKDGKLW+GSVLM FIAVY+LH Sbjct: 362 LQILEDTQGKVVKAVSEVEEKDGKLWIGSVLMSFIAVYELH 402 >ref|XP_004137361.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Cucumis sativus] Length = 402 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 3 LQILEDRQGKVVRAVSEVEEKDGKLWLGSVLMPFIAVYDLH 125 LQILED QGKVV+AVSEVEEKDGKLW+GSVLM FIAVY+LH Sbjct: 362 LQILEDTQGKVVKAVSEVEEKDGKLWIGSVLMSFIAVYELH 402 >dbj|BAE80094.1| strictosidine synthase family protein [Silene latifolia] Length = 59 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 3 LQILEDRQGKVVRAVSEVEEKDGKLWLGSVLMPFIAVYDL 122 LQILEDR GKVV+A+SEVEEKDGKLW+ SVLMPFIA+YDL Sbjct: 14 LQILEDRSGKVVKAISEVEEKDGKLWIASVLMPFIAIYDL 53