BLASTX nr result
ID: Dioscorea21_contig00008818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00008818 (811 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275712.2| PREDICTED: RING finger protein 10-like [Viti... 58 2e-06 emb|CBI21277.3| unnamed protein product [Vitis vinifera] 58 2e-06 >ref|XP_002275712.2| PREDICTED: RING finger protein 10-like [Vitis vinifera] Length = 765 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 259 SFAHVISASRTVDSPEPQKTVGFGKKGKKPTKVLLSTAGGRRY 387 SFA+VIS ++V+S + KT+G GKKGKK ++LLSTAGGRRY Sbjct: 723 SFANVISRGKSVESLDASKTIGTGKKGKKSNQILLSTAGGRRY 765 >emb|CBI21277.3| unnamed protein product [Vitis vinifera] Length = 685 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +1 Query: 259 SFAHVISASRTVDSPEPQKTVGFGKKGKKPTKVLLSTAGGRRY 387 SFA+VIS ++V+S + KT+G GKKGKK ++LLSTAGGRRY Sbjct: 643 SFANVISRGKSVESLDASKTIGTGKKGKKSNQILLSTAGGRRY 685