BLASTX nr result
ID: Dioscorea21_contig00008662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00008662 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280689.1| PREDICTED: uncharacterized protein LOC100260... 55 5e-06 emb|CAN72489.1| hypothetical protein VITISV_028959 [Vitis vinifera] 55 5e-06 >ref|XP_002280689.1| PREDICTED: uncharacterized protein LOC100260870 [Vitis vinifera] Length = 271 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 292 KKKYKVEKARFLDSAGGLNSQWQFYSRLDALIGSSV 185 KKKYK+EK+R DS G L SQW FY RLDALIGS++ Sbjct: 89 KKKYKIEKSRVSDSNGALTSQWPFYERLDALIGSNM 124 >emb|CAN72489.1| hypothetical protein VITISV_028959 [Vitis vinifera] Length = 484 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 292 KKKYKVEKARFLDSAGGLNSQWQFYSRLDALIGSSV 185 KKKYK+EK+R DS G L SQW FY RLDALIGS++ Sbjct: 89 KKKYKIEKSRVSDSNGALTSQWPFYERLDALIGSNM 124