BLASTX nr result
ID: Dioscorea21_contig00008645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00008645 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002984022.1| hypothetical protein SELMODRAFT_119110 [Sela... 61 1e-07 ref|XP_002960119.1| hypothetical protein SELMODRAFT_75504 [Selag... 60 2e-07 gb|ADN34288.1| hypothetical protein [Cucumis melo subsp. melo] 55 6e-06 >ref|XP_002984022.1| hypothetical protein SELMODRAFT_119110 [Selaginella moellendorffii] gi|300148374|gb|EFJ15034.1| hypothetical protein SELMODRAFT_119110 [Selaginella moellendorffii] Length = 347 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 180 CDLSVGKWIPKHEEPLYTNETCDYMASYTNCLKNGR 287 CDLS GKWIP+ PLYTNETC Y+ + NCLKNGR Sbjct: 1 CDLSKGKWIPEAAPPLYTNETCRYIQGHQNCLKNGR 36 >ref|XP_002960119.1| hypothetical protein SELMODRAFT_75504 [Selaginella moellendorffii] gi|300171058|gb|EFJ37658.1| hypothetical protein SELMODRAFT_75504 [Selaginella moellendorffii] Length = 347 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +3 Query: 180 CDLSVGKWIPKHEEPLYTNETCDYMASYTNCLKNGR 287 CDLS GKWIP PLYTNETC Y+ + NCLKNGR Sbjct: 1 CDLSKGKWIPDAAPPLYTNETCRYIQGHQNCLKNGR 36 >gb|ADN34288.1| hypothetical protein [Cucumis melo subsp. melo] Length = 417 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = +3 Query: 141 NFSSWTGAIKNEVCDLSVGKWIPKHEEPLYTNETCDYMASYTNCLKNGR 287 N +S + CD+ G W+PK E+P Y N+TCD M Y NCLK GR Sbjct: 53 NITSLKTVKSEKKCDVFRGAWVPKSEQPYYMNDTCDMMFEYQNCLKYGR 101