BLASTX nr result
ID: Dioscorea21_contig00008485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00008485 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791... 67 1e-09 ref|NP_001119011.1| uncharacerized protein [Arabidopsis thaliana... 58 7e-07 >ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791461 [Glycine max] Length = 41 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 130 MEQVCFWSSCFQDQVMLFQEVLDWRFLILGDFLLISFVNCT 252 ME VCFW++C+Q + FQEVLDWR ILGDFL +SFVNCT Sbjct: 1 MEGVCFWTNCYQYRFFAFQEVLDWRVFILGDFLRVSFVNCT 41 >ref|NP_001119011.1| uncharacerized protein [Arabidopsis thaliana] gi|332658744|gb|AEE84144.1| uncharacerized protein [Arabidopsis thaliana] Length = 41 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 130 MEQVCFWSSCFQDQVMLFQEVLDWRFLILGDFLLISFVNCT 252 MEQV W SC+ ++ FQE LDWRFL+ DFL+ SFVNCT Sbjct: 1 MEQVFVWPSCYHYRLFSFQEALDWRFLVRSDFLVGSFVNCT 41