BLASTX nr result
ID: Dioscorea21_contig00008465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00008465 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138373.1| PREDICTED: ATP synthase delta chain, chlorop... 55 5e-06 ref|XP_002327324.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_004138373.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Cucumis sativus] gi|449503764|ref|XP_004162165.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Cucumis sativus] Length = 240 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 1 GFTIRFGSSTSKLIDLSVKKHLDEIAAQLDFSSISFA 111 GFT+RFG+S SKLIDLSVKK L+EIAAQLD +I A Sbjct: 203 GFTVRFGNSGSKLIDLSVKKQLEEIAAQLDLGNIQLA 239 >ref|XP_002327324.1| predicted protein [Populus trichocarpa] gi|222835694|gb|EEE74129.1| predicted protein [Populus trichocarpa] Length = 250 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 1 GFTIRFGSSTSKLIDLSVKKHLDEIAAQLDFSSISFA 111 GFT+R+G+S SKLID+SVKK L+EIAAQLD S I A Sbjct: 213 GFTVRYGNSGSKLIDMSVKKQLEEIAAQLDLSDIELA 249