BLASTX nr result
ID: Dioscorea21_contig00008457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00008457 (749 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519948.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002519948.1| conserved hypothetical protein [Ricinus communis] gi|223540994|gb|EEF42552.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -2 Query: 448 YDDKRKYSNVGKLLGGPWSRANLEGMEPMLDEFFLNTKKLIRAAKREMGKWR 293 +DDKR+YSNV K GP + + M ++DE +NTKKL++A RE+ KWR Sbjct: 88 HDDKRRYSNVAKFFHGPGNLPTQDEMAGLIDELVINTKKLVQATSREIEKWR 139