BLASTX nr result
ID: Dioscorea21_contig00008051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00008051 (1220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW87431.1| hypothetical protein ZEAMMB73_983706 [Zea mays] 66 2e-08 ref|XP_002437296.1| hypothetical protein SORBIDRAFT_10g024400 [S... 66 2e-08 ref|NP_001183456.1| hypothetical protein [Zea mays] gi|238011216... 66 2e-08 gb|AFW76276.1| hypothetical protein ZEAMMB73_074884 [Zea mays] 64 8e-08 gb|AFW76275.1| hypothetical protein ZEAMMB73_074884 [Zea mays] 64 8e-08 >gb|AFW87431.1| hypothetical protein ZEAMMB73_983706 [Zea mays] Length = 359 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1096 NQSFIFDYTEG-EESGTEEDQVAFMNELETFHREKNLEFKPP 1218 N SF+FDYT G ++SGTEE+Q AFM ELE FHREK LEFKPP Sbjct: 146 NSSFMFDYTTGGDDSGTEEEQAAFMKELERFHREKMLEFKPP 187 >ref|XP_002437296.1| hypothetical protein SORBIDRAFT_10g024400 [Sorghum bicolor] gi|241915519|gb|EER88663.1| hypothetical protein SORBIDRAFT_10g024400 [Sorghum bicolor] Length = 461 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1096 NQSFIFDYTEG-EESGTEEDQVAFMNELETFHREKNLEFKPP 1218 N SF+FDYT G ++SGTEE+Q AFM ELE FHREK LEFKPP Sbjct: 146 NNSFMFDYTTGGDDSGTEEEQAAFMKELERFHREKMLEFKPP 187 >ref|NP_001183456.1| hypothetical protein [Zea mays] gi|238011216|gb|ACR36643.1| unknown [Zea mays] gi|238011680|gb|ACR36875.1| unknown [Zea mays] gi|407232680|gb|AFT82682.1| ARID10 ARID type transcription factor, partial [Zea mays subsp. mays] gi|413954783|gb|AFW87432.1| hypothetical protein ZEAMMB73_983706 [Zea mays] Length = 460 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1096 NQSFIFDYTEG-EESGTEEDQVAFMNELETFHREKNLEFKPP 1218 N SF+FDYT G ++SGTEE+Q AFM ELE FHREK LEFKPP Sbjct: 146 NSSFMFDYTTGGDDSGTEEEQAAFMKELERFHREKMLEFKPP 187 >gb|AFW76276.1| hypothetical protein ZEAMMB73_074884 [Zea mays] Length = 468 Score = 63.9 bits (154), Expect = 8e-08 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1096 NQSFIFDYTEG-EESGTEEDQVAFMNELETFHREKNLEFKPP 1218 + SF+FDYT G ++SGTEE+Q AFM ELE FHREK LEFKPP Sbjct: 153 DNSFMFDYTTGGDDSGTEEEQAAFMKELERFHREKMLEFKPP 194 >gb|AFW76275.1| hypothetical protein ZEAMMB73_074884 [Zea mays] Length = 467 Score = 63.9 bits (154), Expect = 8e-08 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 1096 NQSFIFDYTEG-EESGTEEDQVAFMNELETFHREKNLEFKPP 1218 + SF+FDYT G ++SGTEE+Q AFM ELE FHREK LEFKPP Sbjct: 153 DNSFMFDYTTGGDDSGTEEEQAAFMKELERFHREKMLEFKPP 194