BLASTX nr result
ID: Dioscorea21_contig00007439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00007439 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283456.2| PREDICTED: uncharacterized protein LOC100253... 56 3e-06 emb|CBI16493.3| unnamed protein product [Vitis vinifera] 56 3e-06 >ref|XP_002283456.2| PREDICTED: uncharacterized protein LOC100253539 [Vitis vinifera] Length = 180 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 147 VYEILTEYGLPQGLLPDAVKDYSLSSNGDFVV 242 VY+ILT++GLP+GLLPD+VK YSLS NG+FVV Sbjct: 37 VYDILTQFGLPRGLLPDSVKSYSLSENGEFVV 68 >emb|CBI16493.3| unnamed protein product [Vitis vinifera] Length = 130 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 147 VYEILTEYGLPQGLLPDAVKDYSLSSNGDFVV 242 VY+ILT++GLP+GLLPD+VK YSLS NG+FVV Sbjct: 37 VYDILTQFGLPRGLLPDSVKSYSLSENGEFVV 68