BLASTX nr result
ID: Dioscorea21_contig00007397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00007397 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526100.1| pearli, putative [Ricinus communis] gi|22353... 55 5e-06 >ref|XP_002526100.1| pearli, putative [Ricinus communis] gi|223534597|gb|EEF36294.1| pearli, putative [Ricinus communis] Length = 1758 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/39 (56%), Positives = 35/39 (89%) Frame = -3 Query: 229 SDISIILPTSYQEMVRKYQEFKTALRDDTMDYTTYSANI 113 S+ S +P++YQ++V++YQEFK+AL++D +DYTTY+ANI Sbjct: 1668 SETSTSVPSTYQDLVQRYQEFKSALKEDAVDYTTYTANI 1706