BLASTX nr result
ID: Dioscorea21_contig00007272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00007272 (612 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP80210.1| FCA-like protein [Triticum aestivum] 64 3e-08 ref|XP_002519252.1| Flowering time control protein FCA, putative... 62 8e-08 gb|AAF97846.1|AF127388_1 ABA binding protein [Hordeum vulgare su... 61 1e-07 tpg|DAA39550.1| TPA: hypothetical protein ZEAMMB73_959869 [Zea m... 61 1e-07 ref|NP_001169298.1| uncharacterized protein LOC100383162 [Zea ma... 61 1e-07 >gb|AAP80210.1| FCA-like protein [Triticum aestivum] Length = 424 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 155 HTSPEGYKYYYNSTTRESKWEKPDELVLFE 244 HTSPEG+KYYYNSTTRESKWEKP+E VL+E Sbjct: 371 HTSPEGFKYYYNSTTRESKWEKPEEYVLYE 400 >ref|XP_002519252.1| Flowering time control protein FCA, putative [Ricinus communis] gi|223541567|gb|EEF43116.1| Flowering time control protein FCA, putative [Ricinus communis] Length = 811 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 155 HTSPEGYKYYYNSTTRESKWEKPDELVLFE 244 HTSPEG+KYYYNS TRES+WEKP+EL LFE Sbjct: 652 HTSPEGFKYYYNSVTRESRWEKPEELTLFE 681 >gb|AAF97846.1|AF127388_1 ABA binding protein [Hordeum vulgare subsp. vulgare] Length = 472 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 155 HTSPEGYKYYYNSTTRESKWEKPDELVLFE 244 HTSPEG+KYYYNS TRESKWEKP+E VL+E Sbjct: 352 HTSPEGFKYYYNSITRESKWEKPEEYVLYE 381 >tpg|DAA39550.1| TPA: hypothetical protein ZEAMMB73_959869 [Zea mays] Length = 708 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 155 HTSPEGYKYYYNSTTRESKWEKPDELVLFE 244 HTSPEG+KYYYNS TRESKWEKP+E VL+E Sbjct: 594 HTSPEGFKYYYNSITRESKWEKPEEYVLYE 623 >ref|NP_001169298.1| uncharacterized protein LOC100383162 [Zea mays] gi|224028499|gb|ACN33325.1| unknown [Zea mays] gi|414588978|tpg|DAA39549.1| TPA: hypothetical protein ZEAMMB73_959869 [Zea mays] Length = 735 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 155 HTSPEGYKYYYNSTTRESKWEKPDELVLFE 244 HTSPEG+KYYYNS TRESKWEKP+E VL+E Sbjct: 621 HTSPEGFKYYYNSITRESKWEKPEEYVLYE 650