BLASTX nr result
ID: Dioscorea21_contig00007269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00007269 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA43972.1| TPA: hypothetical protein ZEAMMB73_704083, parti... 65 4e-09 ref|XP_002465697.1| hypothetical protein SORBIDRAFT_01g043970 [S... 65 4e-09 gb|ACR37102.1| unknown [Zea mays] 65 4e-09 ref|NP_001131365.1| uncharacterized protein LOC100192688 [Zea ma... 65 4e-09 gb|EEC74688.1| hypothetical protein OsI_10387 [Oryza sativa Indi... 65 8e-09 >tpg|DAA43972.1| TPA: hypothetical protein ZEAMMB73_704083, partial [Zea mays] Length = 177 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 DTEELQLWDQQIVGLCQALNDILDSMTSKGVMVPV 107 DTEELQ WDQQI GLCQALNDILDSM+SKG+ +PV Sbjct: 143 DTEELQQWDQQIAGLCQALNDILDSMSSKGITIPV 177 >ref|XP_002465697.1| hypothetical protein SORBIDRAFT_01g043970 [Sorghum bicolor] gi|241919551|gb|EER92695.1| hypothetical protein SORBIDRAFT_01g043970 [Sorghum bicolor] Length = 399 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 DTEELQLWDQQIVGLCQALNDILDSMTSKGVMVPV 107 DTEELQ WDQQI GLCQALNDILDSM+SKG+ +PV Sbjct: 365 DTEELQQWDQQIAGLCQALNDILDSMSSKGIAIPV 399 >gb|ACR37102.1| unknown [Zea mays] Length = 57 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 DTEELQLWDQQIVGLCQALNDILDSMTSKGVMVPV 107 DTEELQ WDQQI GLCQALNDILDSM+SKG+ +PV Sbjct: 23 DTEELQQWDQQIAGLCQALNDILDSMSSKGITIPV 57 >ref|NP_001131365.1| uncharacterized protein LOC100192688 [Zea mays] gi|194691326|gb|ACF79747.1| unknown [Zea mays] gi|195639514|gb|ACG39225.1| COP9 signalosome complex subunit 4 [Zea mays] gi|414865414|tpg|DAA43971.1| TPA: COP9 signalosome complex subunit 4 [Zea mays] Length = 399 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 DTEELQLWDQQIVGLCQALNDILDSMTSKGVMVPV 107 DTEELQ WDQQI GLCQALNDILDSM+SKG+ +PV Sbjct: 365 DTEELQQWDQQIAGLCQALNDILDSMSSKGITIPV 399 >gb|EEC74688.1| hypothetical protein OsI_10387 [Oryza sativa Indica Group] Length = 399 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 DTEELQLWDQQIVGLCQALNDILDSMTSKGVMVPV 107 DTEELQ WDQQI GLCQALNDILDSM+SKG+ +PV Sbjct: 365 DTEELQQWDQQIAGLCQALNDILDSMSSKGMAIPV 399