BLASTX nr result
ID: Dioscorea21_contig00006818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00006818 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ30058.1| glutamine synthetase isoform GS1b [Triticum aesti... 103 1e-20 gb|AAZ30059.1| glutamine synthetase isoform GS1c [Triticum aesti... 103 1e-20 gb|AAZ30057.1| glutamine synthetase isoform GS1a [Triticum aesti... 103 1e-20 gb|AFB69879.1| glutamine synthetase isoform 1-1 [Secale cereale] 103 1e-20 gb|AEM42903.1| cytosolic glutamine synthetase isoform [Secale ce... 103 1e-20 >gb|AAZ30058.1| glutamine synthetase isoform GS1b [Triticum aestivum] Length = 356 Score = 103 bits (258), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 337 WGVANRGASIRVGRETEQNGKGYFEDRRPASNMDPYVVTSLVAETTILFKP 185 WGVANRGAS+RVGRETEQNGKGYFEDRRPASNMDPYVVTS++AETTIL+KP Sbjct: 306 WGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 356 >gb|AAZ30059.1| glutamine synthetase isoform GS1c [Triticum aestivum] Length = 356 Score = 103 bits (258), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 337 WGVANRGASIRVGRETEQNGKGYFEDRRPASNMDPYVVTSLVAETTILFKP 185 WGVANRGAS+RVGRETEQNGKGYFEDRRPASNMDPYVVTS++AETTIL+KP Sbjct: 306 WGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 356 >gb|AAZ30057.1| glutamine synthetase isoform GS1a [Triticum aestivum] gi|321531577|gb|ADW94625.1| glutamine synthetase isoform GS1 [Triticum aestivum] Length = 356 Score = 103 bits (258), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 337 WGVANRGASIRVGRETEQNGKGYFEDRRPASNMDPYVVTSLVAETTILFKP 185 WGVANRGAS+RVGRETEQNGKGYFEDRRPASNMDPYVVTS++AETTIL+KP Sbjct: 306 WGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 356 >gb|AFB69879.1| glutamine synthetase isoform 1-1 [Secale cereale] Length = 356 Score = 103 bits (258), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 337 WGVANRGASIRVGRETEQNGKGYFEDRRPASNMDPYVVTSLVAETTILFKP 185 WGVANRGAS+RVGRETEQNGKGYFEDRRPASNMDPYVVTS++AETTIL+KP Sbjct: 306 WGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 356 >gb|AEM42903.1| cytosolic glutamine synthetase isoform [Secale cereale x Triticum durum] Length = 356 Score = 103 bits (258), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 337 WGVANRGASIRVGRETEQNGKGYFEDRRPASNMDPYVVTSLVAETTILFKP 185 WGVANRGAS+RVGRETEQNGKGYFEDRRPASNMDPYVVTS++AETTIL+KP Sbjct: 306 WGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWKP 356