BLASTX nr result
ID: Dioscorea21_contig00006562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00006562 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEI71779.1| JOKA2 [Nicotiana tabacum] 55 6e-06 >gb|AEI71779.1| JOKA2 [Nicotiana tabacum] Length = 843 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = -3 Query: 215 KSHADGKSEPASSTPSNSPNIQTKQLQANV-ITEALNSLPEPLRSTLSKLSEDLLSKATS 39 +S SSTP SP +Q N +++AL S+PEPLR T+ KL DL S+A+S Sbjct: 94 RSSRPSSRSSGSSTPLRSPRVQPPFPNLNSSVSDALKSVPEPLRETVMKLYSDLTSRASS 153 Query: 38 SSPAVAEFVE 9 S+P +AE V+ Sbjct: 154 SAPILAELVD 163