BLASTX nr result
ID: Dioscorea21_contig00006541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00006541 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002461027.1| hypothetical protein SORBIDRAFT_02g039433 [S... 57 2e-06 >ref|XP_002461027.1| hypothetical protein SORBIDRAFT_02g039433 [Sorghum bicolor] gi|241924404|gb|EER97548.1| hypothetical protein SORBIDRAFT_02g039433 [Sorghum bicolor] Length = 108 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/74 (41%), Positives = 48/74 (64%) Frame = -2 Query: 267 FRQWLTKEVDRNHDGRISILELRSALKRKGYDWATWKGILGVVCNDLNHNGFIDTEAEIL 88 F++W+ K+ D +HDGRIS ELR A++R+G ++ + + V D N NGF+D ++EI Sbjct: 34 FKRWV-KQFDTDHDGRISRKELREAIRRRGAWFSGLRALFAVRRADRNRNGFVD-DSEIE 91 Query: 87 ALANYAVRAWGFTI 46 L ++A R GF I Sbjct: 92 GLIDFAERELGFRI 105