BLASTX nr result
ID: Dioscorea21_contig00005909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00005909 (644 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540566.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 97 2e-18 ref|XP_002510641.1| conserved hypothetical protein [Ricinus comm... 97 3e-18 ref|XP_004145533.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 96 4e-18 ref|XP_002301930.1| predicted protein [Populus trichocarpa] gi|2... 96 4e-18 gb|ABK96425.1| unknown [Populus trichocarpa x Populus deltoides] 96 4e-18 >ref|XP_003540566.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Glycine max] Length = 67 Score = 97.4 bits (241), Expect = 2e-18 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 542 IPQPKRWHTITGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWE 417 I QPKRWHTITGKGLCA+MWFWV YRAKQDGPVVLGWRHPWE Sbjct: 16 IHQPKRWHTITGKGLCAVMWFWVFYRAKQDGPVVLGWRHPWE 57 >ref|XP_002510641.1| conserved hypothetical protein [Ricinus communis] gi|223551342|gb|EEF52828.1| conserved hypothetical protein [Ricinus communis] Length = 69 Score = 97.1 bits (240), Expect = 3e-18 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 542 IPQPKRWHTITGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWE 417 I QPKRWH+ITGKGLCA+MWFW+LYRAKQDGPVVLGWRHPWE Sbjct: 16 IHQPKRWHSITGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE 57 >ref|XP_004145533.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 1 [Cucumis sativus] gi|449455587|ref|XP_004145534.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 2 [Cucumis sativus] gi|449485133|ref|XP_004157078.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 1 [Cucumis sativus] gi|449485137|ref|XP_004157079.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 2 [Cucumis sativus] Length = 69 Score = 96.3 bits (238), Expect = 4e-18 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 542 IPQPKRWHTITGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWE 417 I PKRWHT+TGKGLCA+MWFWVLYRAKQDGPVVLGWRHPWE Sbjct: 17 IHPPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE 58 >ref|XP_002301930.1| predicted protein [Populus trichocarpa] gi|222843656|gb|EEE81203.1| predicted protein [Populus trichocarpa] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 536 QPKRWHTITGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWE 417 +PKRWHT+TGKGLCA+MWFWVLYRAKQDGPVVLGWRHPWE Sbjct: 18 KPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE 57 >gb|ABK96425.1| unknown [Populus trichocarpa x Populus deltoides] Length = 68 Score = 96.3 bits (238), Expect = 4e-18 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 536 QPKRWHTITGKGLCAIMWFWVLYRAKQDGPVVLGWRHPWE 417 +PKRWHT+TGKGLCA+MWFWVLYRAKQDGPVVLGWRHPWE Sbjct: 18 KPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE 57