BLASTX nr result
ID: Dioscorea21_contig00005905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00005905 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161388.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 56 3e-06 ref|XP_003567739.1| PREDICTED: AMSH-like ubiquitin thiolesterase... 55 8e-06 >ref|XP_004161388.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Cucumis sativus] Length = 507 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/52 (44%), Positives = 37/52 (71%) Frame = -1 Query: 395 AHQIVKQAKVYREEGNLWDLYFTLVQYSRLMSEVIPQHGGFSTYSSKDKLYH 240 A ++KQA +YREE N+ DL+ L+++S L+SE IP+H + + KDK+Y+ Sbjct: 27 ADNLLKQANIYREENNVVDLFIILLRFSSLVSETIPRHRDYQAFFPKDKIYY 78 >ref|XP_003567739.1| PREDICTED: AMSH-like ubiquitin thiolesterase 3-like [Brachypodium distachyon] Length = 525 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = -1 Query: 395 AHQIVKQAKVYREEGNLWDLYFTLVQYSRLMSEVIPQHGGFSTYSSKDK 249 A +++QA +YREE NL DLY L++YS L+SE IP+H + + S++K Sbjct: 37 ADNLLRQANIYREEKNLLDLYIILLRYSSLLSETIPKHRDYHAFKSREK 85