BLASTX nr result
ID: Dioscorea21_contig00005774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00005774 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK40263.1| unknown [Medicago truncatula] 83 3e-14 ref|XP_003591771.1| Hippocampus abundant transcript-like protein... 83 3e-14 ref|XP_003535506.1| PREDICTED: hippocampus abundant transcript-l... 80 1e-13 ref|XP_003591772.1| Hippocampus abundant transcript-like protein... 79 3e-13 gb|AAX94836.1| Major Facilitator Superfamily, putative [Oryza sa... 79 4e-13 >gb|AFK40263.1| unknown [Medicago truncatula] Length = 442 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 384 FFYKLGMTGISSVLLYYLKTVFGFNKNQFSEILLVVGIGSTFSQVAI 244 FFYKLGMTGI SVLLYYLK VFGFNKNQFSE+L++VGIGS FSQ+ + Sbjct: 246 FFYKLGMTGIHSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVL 292 >ref|XP_003591771.1| Hippocampus abundant transcript-like protein [Medicago truncatula] gi|355480819|gb|AES62022.1| Hippocampus abundant transcript-like protein [Medicago truncatula] Length = 442 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 384 FFYKLGMTGISSVLLYYLKTVFGFNKNQFSEILLVVGIGSTFSQVAI 244 FFYKLGMTGI SVLLYYLK VFGFNKNQFSE+L++VGIGS FSQ+ + Sbjct: 246 FFYKLGMTGIHSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVL 292 >ref|XP_003535506.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Glycine max] Length = 442 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -3 Query: 384 FFYKLGMTGISSVLLYYLKTVFGFNKNQFSEILLVVGIGSTFSQVAI 244 FFY+LGM+GISSVLLYYLK VFGFNKNQFSE+L++VGIGS FSQ+ + Sbjct: 246 FFYELGMSGISSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQMLL 292 >ref|XP_003591772.1| Hippocampus abundant transcript-like protein [Medicago truncatula] gi|355480820|gb|AES62023.1| Hippocampus abundant transcript-like protein [Medicago truncatula] Length = 441 Score = 79.3 bits (194), Expect = 3e-13 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -3 Query: 384 FFYKLGMTGISSVLLYYLKTVFGFNKNQFSEILLVVGIGSTFSQVAI 244 FFY+LGM+GI++VLLYYLK VFGFNKNQFSE+L++VGIGS FSQ+ + Sbjct: 246 FFYELGMSGITTVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQIVL 292 >gb|AAX94836.1| Major Facilitator Superfamily, putative [Oryza sativa Japonica Group] gi|77548658|gb|ABA91455.1| Major Facilitator Superfamily protein, expressed [Oryza sativa Japonica Group] Length = 1143 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 384 FFYKLGMTGISSVLLYYLKTVFGFNKNQFSEILLVVGIGSTFSQVAI 244 FFY+LGM GIS VL+YYLK+VFGF+KNQFSEIL+VVGIGS FSQ+ + Sbjct: 942 FFYELGMIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQILV 988