BLASTX nr result
ID: Dioscorea21_contig00005503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00005503 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46304.1| unknown [Medicago truncatula] 60 5e-13 ref|XP_003604254.1| hypothetical protein MTR_4g007140 [Medicago ... 60 5e-13 ref|NP_001240278.1| uncharacterized protein LOC100803191 [Glycin... 58 3e-12 ref|XP_003530251.1| PREDICTED: unknown protein DS12 from 2D-PAGE... 58 3e-12 gb|AFK46017.1| unknown [Lotus japonicus] 58 3e-12 >gb|AFK46304.1| unknown [Medicago truncatula] Length = 293 Score = 60.5 bits (145), Expect(2) = 5e-13 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 135 MKSLKDLGLNVVKANVFLDSSGKHNKFAITK 227 M++LKDLGLNVVKANVFLDSSGKHNKF+ITK Sbjct: 117 MRALKDLGLNVVKANVFLDSSGKHNKFSITK 147 Score = 38.5 bits (88), Expect(2) = 5e-13 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 1 DMTIVEITFGDRLGALLDTV 60 D T+VEITFGDRLGALLDT+ Sbjct: 98 DATVVEITFGDRLGALLDTM 117 >ref|XP_003604254.1| hypothetical protein MTR_4g007140 [Medicago truncatula] gi|355505309|gb|AES86451.1| hypothetical protein MTR_4g007140 [Medicago truncatula] Length = 293 Score = 60.5 bits (145), Expect(2) = 5e-13 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 135 MKSLKDLGLNVVKANVFLDSSGKHNKFAITK 227 M++LKDLGLNVVKANVFLDSSGKHNKF+ITK Sbjct: 117 MRALKDLGLNVVKANVFLDSSGKHNKFSITK 147 Score = 38.5 bits (88), Expect(2) = 5e-13 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 1 DMTIVEITFGDRLGALLDTV 60 D T+VEITFGDRLGALLDT+ Sbjct: 98 DATVVEITFGDRLGALLDTM 117 >ref|NP_001240278.1| uncharacterized protein LOC100803191 [Glycine max] gi|255644481|gb|ACU22744.1| unknown [Glycine max] Length = 294 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 135 MKSLKDLGLNVVKANVFLDSSGKHNKFAITK 227 M +LK+LGLNVVKANVFLDSSGKHNKF+ITK Sbjct: 118 MNALKNLGLNVVKANVFLDSSGKHNKFSITK 148 Score = 38.5 bits (88), Expect(2) = 3e-12 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 1 DMTIVEITFGDRLGALLDTV 60 D T+VEITFGDRLGALLDT+ Sbjct: 99 DATVVEITFGDRLGALLDTM 118 >ref|XP_003530251.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Glycine max] Length = 291 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 135 MKSLKDLGLNVVKANVFLDSSGKHNKFAITK 227 M +LK+LGLNVVKANVFLDSSGKHNKF+ITK Sbjct: 115 MNALKNLGLNVVKANVFLDSSGKHNKFSITK 145 Score = 38.5 bits (88), Expect(2) = 3e-12 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 1 DMTIVEITFGDRLGALLDTV 60 D T+VEITFGDRLGALLDT+ Sbjct: 96 DATVVEITFGDRLGALLDTM 115 >gb|AFK46017.1| unknown [Lotus japonicus] Length = 290 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 135 MKSLKDLGLNVVKANVFLDSSGKHNKFAITK 227 M +LK+LGLNVVKANV+LDSSGKHNKFAITK Sbjct: 114 MNALKNLGLNVVKANVYLDSSGKHNKFAITK 144 Score = 38.5 bits (88), Expect(2) = 3e-12 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 1 DMTIVEITFGDRLGALLDTV 60 D T+VEITFGDRLGALLDT+ Sbjct: 95 DATVVEITFGDRLGALLDTM 114