BLASTX nr result
ID: Dioscorea21_contig00005204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00005204 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512868.1| (R)-limonene synthase, putative [Ricinus com... 55 8e-06 >ref|XP_002512868.1| (R)-limonene synthase, putative [Ricinus communis] gi|223547879|gb|EEF49371.1| (R)-limonene synthase, putative [Ricinus communis] Length = 599 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = -3 Query: 301 LNTSHFTINSSYEASFTNLAIDIARMSHYFFDYGDGFGKPNHENKDRFFSLMVEPISL 128 +N HF NS + +F LA ++ RMSH ++ GDGFG N K+R SL+++P+SL Sbjct: 538 INEEHFG-NSVFSQTFMRLAKNLGRMSHCMYENGDGFGAQNRHTKERVVSLLIQPLSL 594