BLASTX nr result
ID: Dioscorea21_contig00005092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00005092 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA53961.1| TPA: hypothetical protein ZEAMMB73_441260 [Zea m... 58 7e-07 >tpg|DAA53961.1| TPA: hypothetical protein ZEAMMB73_441260 [Zea mays] Length = 464 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -2 Query: 223 WQANRYIDMYTSTAVIGHPSEDLRHLRELYAQAQTNLQNS-ISSESTLC 80 WQ RYID Y++T+VIG PSEDL+H+ +LY++AQ N S I+S S C Sbjct: 13 WQVKRYIDQYSATSVIGFPSEDLQHIMDLYSRAQENWSASLITSSSETC 61