BLASTX nr result
ID: Dioscorea21_contig00004573
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00004573 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56196.1| hypothetical protein [Jatropha curcas] 60 1e-07 dbj|BAF46300.1| GPI-anchored protein [Ipomoea nil] 60 1e-07 ref|XP_002299077.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_003562009.1| PREDICTED: GPI-anchored protein LORELEI-like... 59 4e-07 ref|XP_004139762.1| PREDICTED: GPI-anchored protein LORELEI-like... 59 5e-07 >gb|ADU56196.1| hypothetical protein [Jatropha curcas] Length = 169 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = -3 Query: 230 SALGDFACPYAQFLNAVFYDCSSVMFSYIHQRTGYPQGLFANECRE 93 +A DFACPYA +N + DC+S MFSYI+ YP GLFA+ECRE Sbjct: 79 AAFKDFACPYADVINDLTSDCASTMFSYINLYGKYPPGLFASECRE 124 >dbj|BAF46300.1| GPI-anchored protein [Ipomoea nil] Length = 170 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = -3 Query: 227 ALGDFACPYAQFLNAVFYDCSSVMFSYIHQRTGYPQGLFANECR 96 A +FACPYA++LN + DC+S MFSYI+ YP GLFANEC+ Sbjct: 80 AFTEFACPYAEYLNDLTNDCASTMFSYINLYGKYPPGLFANECK 123 >ref|XP_002299077.1| predicted protein [Populus trichocarpa] gi|222846335|gb|EEE83882.1| predicted protein [Populus trichocarpa] Length = 155 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -3 Query: 218 DFACPYAQFLNAVFYDCSSVMFSYIHQRTGYPQGLFANECRE 93 +FACPYA +N + DC+S+MFSYI+ YP GLFANEC+E Sbjct: 68 EFACPYADVINDLTNDCASIMFSYINLYGKYPPGLFANECKE 109 >ref|XP_003562009.1| PREDICTED: GPI-anchored protein LORELEI-like [Brachypodium distachyon] Length = 172 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -3 Query: 227 ALGDFACPYAQFLNAVFYDCSSVMFSYIHQRTGYPQGLFANECRE 93 AL DFACPYA ++N +C++ MFS+IH YP GLFAN CRE Sbjct: 81 ALKDFACPYAVYINDPATNCAATMFSFIHLYGKYPPGLFANTCRE 125 >ref|XP_004139762.1| PREDICTED: GPI-anchored protein LORELEI-like [Cucumis sativus] Length = 169 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -3 Query: 230 SALGDFACPYAQFLNAVFYDCSSVMFSYIHQRTGYPQGLFANECRE 93 SAL +FACPY + LN + DC+S MFSYI+ YP GLF++EC+E Sbjct: 80 SALKEFACPYVEDLNDLTNDCASTMFSYINLYGKYPPGLFSSECKE 125