BLASTX nr result
ID: Dioscorea21_contig00003216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00003216 (964 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putativ... 96 2e-17 ref|XP_003588721.1| Fgenesh protein [Medicago truncatula] gi|355... 93 1e-16 ref|XP_003603433.1| Peptidyl-prolyl cis-trans isomerase [Medicag... 92 2e-16 gb|AFW70622.1| hypothetical protein ZEAMMB73_258859 [Zea mays] 91 5e-16 gb|AFW70621.1| hypothetical protein ZEAMMB73_258859 [Zea mays] 91 5e-16 >ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223545494|gb|EEF46999.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Length = 729 Score = 95.5 bits (236), Expect = 2e-17 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = +1 Query: 385 SRSASPDESPKRIRRGRGFSQRYSYARKYRTPTPDRSPVRSRYGGRPDRERYTGYRGY 558 SRS SPD SPKRIRRGRGFS RYSYAR+YRTP+PDRSPVRS GR DR+RY+ YR Y Sbjct: 550 SRSVSPDGSPKRIRRGRGFSDRYSYARRYRTPSPDRSPVRSYRYGRGDRDRYSSYRRY 607 >ref|XP_003588721.1| Fgenesh protein [Medicago truncatula] gi|355477769|gb|AES58972.1| Fgenesh protein [Medicago truncatula] Length = 604 Score = 92.8 bits (229), Expect = 1e-16 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = +1 Query: 385 SRSASPDESPKRIRRGRGFSQRYSYARKYRTPTPDRSPVRSRYGGRPDRERYTGYRGY 558 S+S SPD SPKRIRRGRGFS+RYSYAR+YRTP+ RSPVR RY GR DR+RY+GYR Y Sbjct: 438 SKSVSPDASPKRIRRGRGFSERYSYARRYRTPS--RSPVRYRYNGRNDRDRYSGYRRY 493 >ref|XP_003603433.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355492481|gb|AES73684.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Length = 943 Score = 92.0 bits (227), Expect = 2e-16 Identities = 47/59 (79%), Positives = 51/59 (86%), Gaps = 1/59 (1%) Frame = +1 Query: 385 SRSASPDESPKRIRRGRGFSQRYSYARKYRTPTPDRSPVRS-RYGGRPDRERYTGYRGY 558 SRSASPD SPKRIRRGRGFS+RYSYAR+YRTP+ RSPVRS RY GR DR+RYT YR Y Sbjct: 760 SRSASPDASPKRIRRGRGFSERYSYARRYRTPS--RSPVRSYRYNGRIDRDRYTSYRRY 816 >gb|AFW70622.1| hypothetical protein ZEAMMB73_258859 [Zea mays] Length = 829 Score = 90.5 bits (223), Expect = 5e-16 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = +1 Query: 385 SRSASPDESPKRIRRGRGFSQRYSYARKYRTPTPDRSPVRSRYGGRPDRERYTGYRGYR 561 SRS SPD SPKRIRRGRGF+QRYSYAR+YR+P+ DRS RYGGR DR+RY GYRG R Sbjct: 638 SRSGSPDGSPKRIRRGRGFTQRYSYARQYRSPSADRS---HRYGGRNDRDRYMGYRGSR 693 >gb|AFW70621.1| hypothetical protein ZEAMMB73_258859 [Zea mays] Length = 832 Score = 90.5 bits (223), Expect = 5e-16 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = +1 Query: 385 SRSASPDESPKRIRRGRGFSQRYSYARKYRTPTPDRSPVRSRYGGRPDRERYTGYRGYR 561 SRS SPD SPKRIRRGRGF+QRYSYAR+YR+P+ DRS RYGGR DR+RY GYRG R Sbjct: 638 SRSGSPDGSPKRIRRGRGFTQRYSYARQYRSPSADRS---HRYGGRNDRDRYMGYRGSR 693