BLASTX nr result
ID: Dioscorea21_contig00003146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00003146 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] 77 1e-12 gb|AFK48186.1| unknown [Lotus japonicus] 77 1e-12 ref|XP_003546330.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 77 1e-12 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like ... 77 1e-12 ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatu... 77 1e-12 >dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] Length = 61 Score = 77.0 bits (188), Expect = 1e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 1 HKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHNN 105 H+NGIKKPR+HRHTST+GMDPKFLRNQRYARKHNN Sbjct: 17 HRNGIKKPRKHRHTSTRGMDPKFLRNQRYARKHNN 51 >gb|AFK48186.1| unknown [Lotus japonicus] Length = 61 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 HKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHN 102 HKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN Sbjct: 17 HKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHN 50 >ref|XP_003546330.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] Length = 61 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 HKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHN 102 HKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN Sbjct: 17 HKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHN 50 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356529227|ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356564681|ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] Length = 61 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 HKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHN 102 HKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN Sbjct: 17 HKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHN 50 >ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatula] gi|355510808|gb|AES91950.1| 60S ribosomal protein L29 [Medicago truncatula] Length = 445 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 HKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHN 102 HKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN Sbjct: 153 HKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHN 186 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 HKNGIKKPRRHRHTSTKGMDPKFLRNQRYARKHN 102 HKNGIKKP+RHRHTSTKGMDPKFLRNQRYARKHN Sbjct: 401 HKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHN 434