BLASTX nr result
ID: Dioscorea21_contig00000601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00000601 (582 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 196 3e-48 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 196 3e-48 ref|XP_002277021.1| PREDICTED: thioredoxin F, chloroplastic [Vit... 191 6e-47 ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus commun... 191 8e-47 ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|111354... 189 2e-46 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Length = 182 Score = 196 bits (497), Expect = 3e-48 Identities = 93/108 (86%), Positives = 101/108 (93%) Frame = +2 Query: 257 TVGQVTEVCKDTFWPLVKASGSKIVVLDMYTQWCGPCKVIAPKFKELSEKYLDVVFLKLD 436 TVGQVTEV KDTFWP+V A+G K VVLDMYTQWCGPCKVIAPK+KEL+EKYLDVVFLKLD Sbjct: 73 TVGQVTEVNKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKYKELAEKYLDVVFLKLD 132 Query: 437 CNQENKSLAKELGIRVVPTFKILKDGNIVKEVTGAKFDDLVFAIDTVK 580 CNQ+NK LAKELGI+VVPTFKILKD IVKEVTGAK+DDLVFAIDTV+ Sbjct: 133 CNQDNKPLAKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVR 180 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 196 bits (497), Expect = 3e-48 Identities = 93/108 (86%), Positives = 101/108 (93%) Frame = +2 Query: 257 TVGQVTEVCKDTFWPLVKASGSKIVVLDMYTQWCGPCKVIAPKFKELSEKYLDVVFLKLD 436 TVGQVTEV KDTFWP+V A+G K VVLDMYTQWCGPCKVIAPK+KEL+EKYLDVVFLKLD Sbjct: 77 TVGQVTEVNKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKYKELAEKYLDVVFLKLD 136 Query: 437 CNQENKSLAKELGIRVVPTFKILKDGNIVKEVTGAKFDDLVFAIDTVK 580 CNQ+NK LAKELGI+VVPTFKILKD IVKEVTGAK+DDLVFAIDTV+ Sbjct: 137 CNQDNKPLAKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVR 184 >ref|XP_002277021.1| PREDICTED: thioredoxin F, chloroplastic [Vitis vinifera] gi|297735248|emb|CBI17610.3| unnamed protein product [Vitis vinifera] Length = 172 Score = 191 bits (486), Expect = 6e-47 Identities = 92/114 (80%), Positives = 102/114 (89%) Frame = +2 Query: 239 LEIARPTVGQVTEVCKDTFWPLVKASGSKIVVLDMYTQWCGPCKVIAPKFKELSEKYLDV 418 ++ A VGQVTEV KDTFWP+VKA+G K VVLDMYTQWCGPCKV+APKF+ELS KYLDV Sbjct: 57 IDTAEAVVGQVTEVNKDTFWPIVKAAGDKAVVLDMYTQWCGPCKVMAPKFQELSGKYLDV 116 Query: 419 VFLKLDCNQENKSLAKELGIRVVPTFKILKDGNIVKEVTGAKFDDLVFAIDTVK 580 VFLKLDCNQ+NK+LAKELGIRVVPTFKILKD IVKEVTGAK DDLV AI+TV+ Sbjct: 117 VFLKLDCNQDNKTLAKELGIRVVPTFKILKDSKIVKEVTGAKLDDLVVAIETVR 170 >ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus communis] gi|223545881|gb|EEF47384.1| thioredoxin f-type, putative [Ricinus communis] Length = 186 Score = 191 bits (485), Expect = 8e-47 Identities = 89/110 (80%), Positives = 101/110 (91%) Frame = +2 Query: 251 RPTVGQVTEVCKDTFWPLVKASGSKIVVLDMYTQWCGPCKVIAPKFKELSEKYLDVVFLK 430 R TVGQVTEV KDTFWP+VK++G K VVLDMYTQWCGPCK++APKF++LSEKYLDVVFLK Sbjct: 75 RATVGQVTEVSKDTFWPIVKSAGDKTVVLDMYTQWCGPCKIMAPKFQQLSEKYLDVVFLK 134 Query: 431 LDCNQENKSLAKELGIRVVPTFKILKDGNIVKEVTGAKFDDLVFAIDTVK 580 LDCNQ+NK LAKELGIRVVPTFKILKD +VKEVTG+KFDDLV AI+ V+ Sbjct: 135 LDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGSKFDDLVAAIEAVR 184 >ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|11135405|sp|Q9XFH9.1|TRXF2_ARATH RecName: Full=Thioredoxin F2, chloroplastic; Short=AtTrxf2; AltName: Full=Thioredoxin F1; Short=AtTrxf1; Flags: Precursor gi|4973254|gb|AAD35004.1|AF144386_1 thioredoxin f2 [Arabidopsis thaliana] gi|13878187|gb|AAK44171.1|AF370356_1 putative thioredoxin f2 protein [Arabidopsis thaliana] gi|9759122|dbj|BAB09607.1| thioredoxin f2 [Arabidopsis thaliana] gi|16323396|gb|AAL15192.1| putative thioredoxin f2 protein [Arabidopsis thaliana] gi|332004905|gb|AED92288.1| thioredoxin F2 [Arabidopsis thaliana] Length = 185 Score = 189 bits (481), Expect = 2e-46 Identities = 90/114 (78%), Positives = 101/114 (88%) Frame = +2 Query: 239 LEIARPTVGQVTEVCKDTFWPLVKASGSKIVVLDMYTQWCGPCKVIAPKFKELSEKYLDV 418 LE TVGQVTEV KDTFWP+VKA+G KIVVLDMYTQWCGPCKVIAPK+KELSEKY D+ Sbjct: 70 LETVNVTVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDM 129 Query: 419 VFLKLDCNQENKSLAKELGIRVVPTFKILKDGNIVKEVTGAKFDDLVFAIDTVK 580 VFLKLDCNQ+NK LAKELGIRVVPTFKILKD +VKEVTGAK++DL+ AI+ + Sbjct: 130 VFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAAR 183