BLASTX nr result
ID: Dioscorea21_contig00000438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00000438 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633181.1| PREDICTED: eukaryotic initiation factor iso-... 65 4e-09 ref|XP_002277218.2| PREDICTED: eukaryotic initiation factor iso-... 65 4e-09 emb|CBI36548.3| unnamed protein product [Vitis vinifera] 65 4e-09 emb|CAN70546.1| hypothetical protein VITISV_013807 [Vitis vinifera] 65 4e-09 ref|XP_002285559.2| PREDICTED: eukaryotic initiation factor iso-... 64 1e-08 >ref|XP_003633181.1| PREDICTED: eukaryotic initiation factor iso-4F subunit p82-34-like isoform 2 [Vitis vinifera] Length = 795 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/44 (75%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +3 Query: 339 RFDG-DRVRYTRDQLLQLRENVDVPEAILKVKQGIESELFGEEQ 467 RF+G +RVR+TRD+LLQLRE VDVPE ILK+KQ IE+ELFGE+Q Sbjct: 68 RFEGRERVRFTRDKLLQLREVVDVPEDILKIKQEIEAELFGEDQ 111 >ref|XP_002277218.2| PREDICTED: eukaryotic initiation factor iso-4F subunit p82-34-like isoform 1 [Vitis vinifera] Length = 794 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/44 (75%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +3 Query: 339 RFDG-DRVRYTRDQLLQLRENVDVPEAILKVKQGIESELFGEEQ 467 RF+G +RVR+TRD+LLQLRE VDVPE ILK+KQ IE+ELFGE+Q Sbjct: 68 RFEGRERVRFTRDKLLQLREVVDVPEDILKIKQEIEAELFGEDQ 111 >emb|CBI36548.3| unnamed protein product [Vitis vinifera] Length = 630 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/44 (75%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +3 Query: 339 RFDG-DRVRYTRDQLLQLRENVDVPEAILKVKQGIESELFGEEQ 467 RF+G +RVR+TRD+LLQLRE VDVPE ILK+KQ IE+ELFGE+Q Sbjct: 68 RFEGRERVRFTRDKLLQLREVVDVPEDILKIKQEIEAELFGEDQ 111 >emb|CAN70546.1| hypothetical protein VITISV_013807 [Vitis vinifera] Length = 794 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/44 (75%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +3 Query: 339 RFDG-DRVRYTRDQLLQLRENVDVPEAILKVKQGIESELFGEEQ 467 RF+G +RVR+TRD+LLQLRE VDVPE ILK+KQ IE+ELFGE+Q Sbjct: 68 RFEGRERVRFTRDKLLQLREVVDVPEDILKIKQEIEAELFGEDQ 111 >ref|XP_002285559.2| PREDICTED: eukaryotic initiation factor iso-4F subunit p82-34-like [Vitis vinifera] Length = 791 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = +3 Query: 339 RFDG-DRVRYTRDQLLQLRENVDVPEAILKVKQGIESELFGEEQ 467 RF+G +RVRYTRDQLLQLRE VD+PE ILK+KQ IESE GE+Q Sbjct: 60 RFEGRERVRYTRDQLLQLREVVDIPENILKIKQEIESEFGGEDQ 103