BLASTX nr result
ID: Dioscorea21_contig00000267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00000267 (600 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF06504.1| 60S ribosomal protein L28 [Elaeis guineensis] 72 1e-10 gb|ACF06437.1| ribosomal L28-like protein [Elaeis guineensis] 70 2e-10 ref|XP_002514169.1| 60S ribosomal protein L28, putative [Ricinus... 68 1e-09 ref|XP_004146830.1| PREDICTED: 60S ribosomal protein L28-2-like ... 64 3e-08 gb|AEO32764.1| hypothetical protein [Amblyomma maculatum] 64 3e-08 >gb|ACF06504.1| 60S ribosomal protein L28 [Elaeis guineensis] Length = 148 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 YKHSGLANKKSVSIQPGGEGLSVTLGTTKTKKQNKPSSLYN 125 YKHSGLANKK+VSIQPGG+ LSV L TTKTKKQNKP++LY+ Sbjct: 46 YKHSGLANKKTVSIQPGGKDLSVVLATTKTKKQNKPANLYH 86 >gb|ACF06437.1| ribosomal L28-like protein [Elaeis guineensis] Length = 148 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +3 Query: 3 YKHSGLANKKSVSIQPGGEGLSVTLGTTKTKKQNKPSSLYN 125 YKHSGLANKK+V+IQPGG+ LSV L T+KTKKQNKP +LYN Sbjct: 46 YKHSGLANKKTVAIQPGGKDLSVVLATSKTKKQNKPGNLYN 86 >ref|XP_002514169.1| 60S ribosomal protein L28, putative [Ricinus communis] gi|223546625|gb|EEF48123.1| 60S ribosomal protein L28, putative [Ricinus communis] Length = 144 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 3 YKHSGLANKKSVSIQPGGEGLSVTLGTTKTKKQNKPSS 116 YKHSGLANKK+VSIQPGG+ LSV L TTKTKKQNKP+S Sbjct: 46 YKHSGLANKKTVSIQPGGKDLSVVLATTKTKKQNKPAS 83 >ref|XP_004146830.1| PREDICTED: 60S ribosomal protein L28-2-like isoform 1 [Cucumis sativus] gi|449458191|ref|XP_004146831.1| PREDICTED: 60S ribosomal protein L28-2-like isoform 2 [Cucumis sativus] gi|449476678|ref|XP_004154804.1| PREDICTED: 60S ribosomal protein L28-2-like isoform 1 [Cucumis sativus] gi|449476681|ref|XP_004154805.1| PREDICTED: 60S ribosomal protein L28-2-like isoform 2 [Cucumis sativus] Length = 148 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 YKHSGLANKKSVSIQPGGEGLSVTLGTTKTKKQNKPSS 116 YKHSGLANKK+V+IQPGG+ S+ L TTK+KKQNKPSS Sbjct: 46 YKHSGLANKKTVTIQPGGKDQSILLATTKSKKQNKPSS 83 >gb|AEO32764.1| hypothetical protein [Amblyomma maculatum] Length = 168 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/42 (73%), Positives = 38/42 (90%), Gaps = 1/42 (2%) Frame = +3 Query: 3 YKHSGLANKKSVSIQP-GGEGLSVTLGTTKTKKQNKPSSLYN 125 +KHSGLANKK+VSIQP GG+ LSV + TTKTKKQ+KP+SLY+ Sbjct: 67 FKHSGLANKKTVSIQPAGGKDLSVVVATTKTKKQSKPASLYH 108