BLASTX nr result
ID: Dioscorea21_contig00000102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00000102 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-3-like ... 75 4e-12 ref|XP_003554636.1| PREDICTED: 60S ribosomal protein L18-3-like ... 75 4e-12 ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Sela... 75 4e-12 ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Sela... 75 4e-12 gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum] 75 4e-12 >ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-3-like [Glycine max] Length = 187 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 GPAPGVPHSSTKPYVRAKGRKFEKARGRRNSRGFRV 110 GPAPGVPHS TKPYVRAKGRKFE+ARGRRNSRGFRV Sbjct: 152 GPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV 187 >ref|XP_003554636.1| PREDICTED: 60S ribosomal protein L18-3-like [Glycine max] Length = 187 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 GPAPGVPHSSTKPYVRAKGRKFEKARGRRNSRGFRV 110 GPAPGVPHS TKPYVRAKGRKFE+ARGRRNSRGFRV Sbjct: 152 GPAPGVPHSHTKPYVRAKGRKFERARGRRNSRGFRV 187 >ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii] gi|300156055|gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii] Length = 187 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 GPAPGVPHSSTKPYVRAKGRKFEKARGRRNSRGFRV 110 GPAPGVPHS TKPYVR+KGRKFEKARGRRNSRGFRV Sbjct: 152 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV 187 >ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii] gi|300146395|gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii] Length = 187 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 GPAPGVPHSSTKPYVRAKGRKFEKARGRRNSRGFRV 110 GPAPGVPHS TKPYVR+KGRKFEKARGRRNSRGFRV Sbjct: 152 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV 187 >gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum] Length = 154 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 GPAPGVPHSSTKPYVRAKGRKFEKARGRRNSRGFRV 110 GPAPGVPHS TKPYVR+KGRKFEKARGRRNSRGFRV Sbjct: 119 GPAPGVPHSHTKPYVRSKGRKFEKARGRRNSRGFRV 154