BLASTX nr result
ID: Dioscorea21_contig00000029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00000029 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] 67 1e-09 gb|AAM65746.1| AP2 domain containing protein, putative [Arabidop... 66 3e-09 ref|NP_175794.1| ethylene-responsive transcription factor RAP2-1... 66 3e-09 ref|NP_001077718.1| ethylene-responsive transcription factor RAP... 66 3e-09 dbj|BAJ34297.1| unnamed protein product [Thellungiella halophila] 66 3e-09 >gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] Length = 348 Score = 67.4 bits (163), Expect = 1e-09 Identities = 33/56 (58%), Positives = 40/56 (71%), Gaps = 6/56 (10%) Frame = +1 Query: 61 MCGGAIISDYIPPARSRRLTAEILWPDLEKNNKASGFKSWE------WEFDDDFEA 210 MCGGAIISD+IPPARSR+LTA+ LWP+L+K A S + +E DDDFEA Sbjct: 1 MCGGAIISDFIPPARSRKLTADYLWPNLKKGGNAKSLSSKKKKTKSSFEVDDDFEA 56 >gb|AAM65746.1| AP2 domain containing protein, putative [Arabidopsis thaliana] Length = 358 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 4/54 (7%) Frame = +1 Query: 61 MCGGAIISDYIPPARSRRLTAEILWPDLEKN----NKASGFKSWEWEFDDDFEA 210 MCGGAIISD+IPP RSRR+T+E +WPDL+KN K+S +S ++FD +FEA Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEA 54 >ref|NP_175794.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|79319902|ref|NP_001031185.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|75337589|sp|Q9SSA8.1|RA212_ARATH RecName: Full=Ethylene-responsive transcription factor RAP2-12; AltName: Full=Protein RELATED TO APETALA2 12 gi|6056399|gb|AAF02863.1|AC009324_12 AP2 domain containing protein RAP2.12 [Arabidopsis thaliana] gi|14335162|gb|AAK59861.1| At1g53910/T18A20_14 [Arabidopsis thaliana] gi|15982876|gb|AAL09785.1| At1g53910/T18A20_14 [Arabidopsis thaliana] gi|21360487|gb|AAM47359.1| At1g53910/T18A20_14 [Arabidopsis thaliana] gi|222423411|dbj|BAH19677.1| AT1G53910 [Arabidopsis thaliana] gi|332194901|gb|AEE33022.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|332194902|gb|AEE33023.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] Length = 358 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 4/54 (7%) Frame = +1 Query: 61 MCGGAIISDYIPPARSRRLTAEILWPDLEKN----NKASGFKSWEWEFDDDFEA 210 MCGGAIISD+IPP RSRR+T+E +WPDL+KN K+S +S ++FD +FEA Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEA 54 >ref|NP_001077718.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|332194903|gb|AEE33024.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] Length = 356 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/54 (59%), Positives = 42/54 (77%), Gaps = 4/54 (7%) Frame = +1 Query: 61 MCGGAIISDYIPPARSRRLTAEILWPDLEKN----NKASGFKSWEWEFDDDFEA 210 MCGGAIISD+IPP RSRR+T+E +WPDL+KN K+S +S ++FD +FEA Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEA 54 >dbj|BAJ34297.1| unnamed protein product [Thellungiella halophila] Length = 359 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/54 (57%), Positives = 42/54 (77%), Gaps = 4/54 (7%) Frame = +1 Query: 61 MCGGAIISDYIPPARSRRLTAEILWPDLEKN----NKASGFKSWEWEFDDDFEA 210 MCGGAIISD+IPP RSRR+T+E +WPDL+KN ++S +S ++ DD+FEA Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNVKGLKRSSKKRSNFFDLDDEFEA 54