BLASTX nr result
ID: Cornus23_contig00046134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00046134 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010259025.1| PREDICTED: protein YABBY 4-like [Nelumbo nuc... 59 1e-06 ref|XP_007052114.1| Plant-specific transcription factor YABBY fa... 57 7e-06 ref|XP_007052113.1| Plant-specific transcription factor YABBY fa... 57 7e-06 >ref|XP_010259025.1| PREDICTED: protein YABBY 4-like [Nelumbo nucifera] Length = 211 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 278 KKPNVRQQEGDDVLMKDGFFASTSLGVSPY 189 KKPNVRQQEG+DVLMKDGFFAS ++GVSPY Sbjct: 182 KKPNVRQQEGEDVLMKDGFFASANVGVSPY 211 >ref|XP_007052114.1| Plant-specific transcription factor YABBY family protein isoform 2 [Theobroma cacao] gi|508704375|gb|EOX96271.1| Plant-specific transcription factor YABBY family protein isoform 2 [Theobroma cacao] Length = 154 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 278 KKPNVRQQEGDDVLMKDGFFASTSLGVSPY 189 KK NVRQQEG+DVLMKDGFFAST++GV+PY Sbjct: 125 KKTNVRQQEGEDVLMKDGFFASTNVGVTPY 154 >ref|XP_007052113.1| Plant-specific transcription factor YABBY family protein isoform 1 [Theobroma cacao] gi|508704374|gb|EOX96270.1| Plant-specific transcription factor YABBY family protein isoform 1 [Theobroma cacao] Length = 212 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 278 KKPNVRQQEGDDVLMKDGFFASTSLGVSPY 189 KK NVRQQEG+DVLMKDGFFAST++GV+PY Sbjct: 183 KKTNVRQQEGEDVLMKDGFFASTNVGVTPY 212