BLASTX nr result
ID: Cornus23_contig00046074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00046074 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009758380.1| PREDICTED: zinc finger protein ZAT9-like [Ni... 65 2e-08 ref|XP_009615913.1| PREDICTED: zinc finger protein ZAT9 [Nicotia... 65 2e-08 ref|XP_004242283.1| PREDICTED: zinc finger protein ZAT4 [Solanum... 63 7e-08 >ref|XP_009758380.1| PREDICTED: zinc finger protein ZAT9-like [Nicotiana sylvestris] Length = 321 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = -1 Query: 318 ALGGHKRSHYLSSSSTTDATNTFKFGESLVDTSCAKVGESLIDLNLPAPMEDE 160 ALGGHKRSH LSSS+T A+++ K G+SL+D+S AK IDLN+PAP+EDE Sbjct: 260 ALGGHKRSHLLSSSTT--ASSSSKIGDSLMDSSSAKFPNGFIDLNMPAPIEDE 310 >ref|XP_009615913.1| PREDICTED: zinc finger protein ZAT9 [Nicotiana tomentosiformis] Length = 313 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = -1 Query: 318 ALGGHKRSHYLSSSSTTDATNTFKFGESLVDTSCAKVGESLIDLNLPAPMEDE 160 ALGGHKRSH LSSS+T A+++ K G+SL+D+S AK IDLN+PAP+EDE Sbjct: 252 ALGGHKRSHILSSSTT--ASSSSKVGDSLMDSSSAKFPNGFIDLNMPAPIEDE 302 >ref|XP_004242283.1| PREDICTED: zinc finger protein ZAT4 [Solanum lycopersicum] Length = 306 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = -1 Query: 318 ALGGHKRSHYLSSSSTTDATNTFKFGESLVDTSCAKVGESLIDLNLPAPMEDE 160 ALGGHKR+H LSSS T A+++ K G+SL+D+S AK IDLN+PAPMEDE Sbjct: 252 ALGGHKRTHILSSSIT--ASSSSKVGDSLMDSSSAKFPFGFIDLNMPAPMEDE 302