BLASTX nr result
ID: Cornus23_contig00046057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00046057 (352 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008240452.1| PREDICTED: aquaporin SIP1-2 [Prunus mume] 57 4e-06 ref|XP_004302154.1| PREDICTED: aquaporin SIP1-2 [Fragaria vesca ... 57 5e-06 >ref|XP_008240452.1| PREDICTED: aquaporin SIP1-2 [Prunus mume] Length = 243 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 291 GDALGGATFHPTTTASFYAAGDGIDSLISMAFHFLAQVL 175 GDALGGA+F+PT TASFYAAG G D+L+SMA F AQ L Sbjct: 63 GDALGGASFNPTGTASFYAAGLGADTLLSMALRFPAQAL 101 >ref|XP_004302154.1| PREDICTED: aquaporin SIP1-2 [Fragaria vesca subsp. vesca] Length = 237 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -2 Query: 291 GDALGGATFHPTTTASFYAAGDGIDSLISMAFHFLAQVL 175 GDALGGA+F+PT TASFYAAG G D+L SMA F AQ L Sbjct: 62 GDALGGASFNPTGTASFYAAGVGADTLFSMALRFPAQTL 100